Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RGF7

Protein Details
Accession E3RGF7   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-71LMAMKKKKKKSPMAVCEEKKHydrophilic
NLS Segment(s)
PositionSequence
56-61KKKKKK
Subcellular Location(s) mito 18.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
KEGG pte:PTT_06878  -  
Amino Acid Sequences MRSRHLARLTALYPSCKTANPMNVIQRSPPASHAAAVATAYEFRTGTYETGLMAMKKKKKKSPMAVCEEKKIFMFLARADIQPISRVGIGETTQPALVSQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.26
4 0.29
5 0.28
6 0.33
7 0.34
8 0.38
9 0.42
10 0.44
11 0.44
12 0.42
13 0.39
14 0.36
15 0.32
16 0.28
17 0.24
18 0.21
19 0.21
20 0.2
21 0.16
22 0.13
23 0.12
24 0.1
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.08
38 0.09
39 0.08
40 0.11
41 0.16
42 0.23
43 0.3
44 0.36
45 0.42
46 0.51
47 0.6
48 0.67
49 0.73
50 0.75
51 0.78
52 0.81
53 0.77
54 0.74
55 0.65
56 0.55
57 0.45
58 0.36
59 0.27
60 0.19
61 0.19
62 0.13
63 0.18
64 0.19
65 0.19
66 0.19
67 0.2
68 0.18
69 0.18
70 0.18
71 0.14
72 0.13
73 0.13
74 0.12
75 0.14
76 0.14
77 0.16
78 0.17
79 0.16
80 0.16
81 0.15