Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RWF4

Protein Details
Accession E3RWF4   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-44LDKDLTKEVRTPKRPRRRAKTPKPKLSKKLDYTIBasic
NLS Segment(s)
PositionSequence
20-39RTPKRPRRRAKTPKPKLSKK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
KEGG pte:PTT_13617  -  
Amino Acid Sequences MSNSLSNDNDLDKDLTKEVRTPKRPRRRAKTPKPKLSKKLDYTIYYSSRLASRPAIPPIVLAISSKDRSERDSEEDNSNNSDTKSEDAFDSLPSREVDSDSSLEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.25
5 0.33
6 0.41
7 0.49
8 0.57
9 0.66
10 0.74
11 0.83
12 0.88
13 0.88
14 0.89
15 0.91
16 0.92
17 0.93
18 0.93
19 0.93
20 0.93
21 0.93
22 0.9
23 0.89
24 0.87
25 0.81
26 0.77
27 0.72
28 0.64
29 0.59
30 0.55
31 0.47
32 0.39
33 0.34
34 0.28
35 0.23
36 0.21
37 0.19
38 0.16
39 0.16
40 0.17
41 0.19
42 0.18
43 0.17
44 0.16
45 0.15
46 0.13
47 0.11
48 0.08
49 0.08
50 0.11
51 0.13
52 0.13
53 0.15
54 0.15
55 0.18
56 0.22
57 0.23
58 0.24
59 0.29
60 0.32
61 0.35
62 0.37
63 0.35
64 0.34
65 0.31
66 0.27
67 0.22
68 0.19
69 0.15
70 0.16
71 0.15
72 0.14
73 0.13
74 0.14
75 0.15
76 0.16
77 0.18
78 0.16
79 0.17
80 0.17
81 0.19
82 0.17
83 0.19
84 0.19
85 0.2