Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RXV5

Protein Details
Accession E3RXV5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
115-142SESMRRTGLRNKPGRKPQWRWTEKTGKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG pte:PTT_14284  -  
Amino Acid Sequences MRNDRLRWAIDHKDWTLEDWKNVIWTDETSVVINHRRGGYRVWRKADERVVKSCIRERWKGYSEFMFWGSFSYDKKGPCHVYQPETKAEREDAAQKIEQLNAELEPIQREEWELSESMRRTGLRNKPGRKPQWRWTEKTGKLSVSKIDLRQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.43
4 0.37
5 0.33
6 0.29
7 0.28
8 0.26
9 0.26
10 0.24
11 0.17
12 0.16
13 0.17
14 0.17
15 0.17
16 0.15
17 0.16
18 0.18
19 0.21
20 0.22
21 0.22
22 0.22
23 0.23
24 0.24
25 0.29
26 0.36
27 0.42
28 0.48
29 0.51
30 0.53
31 0.54
32 0.59
33 0.63
34 0.61
35 0.55
36 0.52
37 0.51
38 0.48
39 0.49
40 0.48
41 0.46
42 0.43
43 0.44
44 0.43
45 0.46
46 0.48
47 0.48
48 0.44
49 0.4
50 0.36
51 0.32
52 0.29
53 0.21
54 0.17
55 0.15
56 0.14
57 0.12
58 0.1
59 0.12
60 0.14
61 0.15
62 0.17
63 0.21
64 0.24
65 0.24
66 0.3
67 0.3
68 0.31
69 0.34
70 0.36
71 0.38
72 0.37
73 0.36
74 0.3
75 0.28
76 0.24
77 0.21
78 0.24
79 0.19
80 0.19
81 0.19
82 0.19
83 0.19
84 0.19
85 0.18
86 0.14
87 0.13
88 0.1
89 0.1
90 0.1
91 0.1
92 0.1
93 0.11
94 0.1
95 0.09
96 0.1
97 0.1
98 0.11
99 0.12
100 0.11
101 0.11
102 0.17
103 0.17
104 0.17
105 0.2
106 0.19
107 0.21
108 0.3
109 0.38
110 0.43
111 0.52
112 0.58
113 0.65
114 0.75
115 0.82
116 0.83
117 0.82
118 0.82
119 0.84
120 0.84
121 0.81
122 0.8
123 0.8
124 0.76
125 0.77
126 0.71
127 0.65
128 0.62
129 0.58
130 0.52
131 0.49
132 0.48