Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3RZV1

Protein Details
Accession E3RZV1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-40LDKDLTKEVRTPKRPRRRAKTPEPKLSKELBasic
NLS Segment(s)
PositionSequence
20-35RTPKRPRRRAKTPEPK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
KEGG pte:PTT_15270  -  
Amino Acid Sequences MSNSLSNDNDLDKDLTKEVRTPKRPRRRAKTPEPKLSKELNYTIRRSSRLASRPTVPPIILAISSKDRSERNLEEDNSNDSDTKSKDAFDSLPPREVDSDSSLEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.25
5 0.33
6 0.41
7 0.49
8 0.57
9 0.66
10 0.74
11 0.83
12 0.88
13 0.88
14 0.89
15 0.9
16 0.91
17 0.91
18 0.9
19 0.9
20 0.87
21 0.81
22 0.75
23 0.7
24 0.62
25 0.55
26 0.51
27 0.49
28 0.46
29 0.44
30 0.44
31 0.42
32 0.41
33 0.38
34 0.35
35 0.34
36 0.35
37 0.37
38 0.34
39 0.35
40 0.36
41 0.37
42 0.36
43 0.28
44 0.21
45 0.18
46 0.16
47 0.13
48 0.11
49 0.1
50 0.13
51 0.14
52 0.14
53 0.16
54 0.16
55 0.18
56 0.25
57 0.25
58 0.27
59 0.33
60 0.34
61 0.34
62 0.35
63 0.36
64 0.32
65 0.3
66 0.25
67 0.18
68 0.21
69 0.2
70 0.22
71 0.19
72 0.18
73 0.18
74 0.21
75 0.22
76 0.26
77 0.34
78 0.33
79 0.37
80 0.37
81 0.38
82 0.38
83 0.37
84 0.32
85 0.28