Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S019

Protein Details
Accession E3S019   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-58QGLAQEPGSPRRRRRRRRHHTITAPYAGSHydrophilic
NLS Segment(s)
PositionSequence
38-48SPRRRRRRRRH
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
KEGG pte:PTT_15355  -  
pte:PTT_18641  -  
Amino Acid Sequences MLPPTNATDREADRAVSSSSPPNRAHLLSQGLAQEPGSPRRRRRRRRHHTITAPYAGSATSGGPLPRRPASQSAAPVTPSQRIAVAPTNSLTAPSSVSIFVPGTAEPLQRSKSSRNGKHWELLPARVHHKDDDVTHYGALGSRSTWEAAHAKRLLAAEAEVGRVDTKWDGGVIVDYSAQDRKREERARGFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.21
4 0.21
5 0.25
6 0.28
7 0.34
8 0.34
9 0.35
10 0.38
11 0.38
12 0.37
13 0.34
14 0.34
15 0.28
16 0.3
17 0.28
18 0.25
19 0.24
20 0.22
21 0.2
22 0.19
23 0.27
24 0.33
25 0.38
26 0.47
27 0.58
28 0.69
29 0.76
30 0.84
31 0.87
32 0.9
33 0.94
34 0.95
35 0.94
36 0.94
37 0.92
38 0.88
39 0.81
40 0.7
41 0.58
42 0.48
43 0.36
44 0.26
45 0.17
46 0.1
47 0.06
48 0.07
49 0.08
50 0.09
51 0.11
52 0.15
53 0.17
54 0.18
55 0.2
56 0.24
57 0.26
58 0.29
59 0.31
60 0.3
61 0.29
62 0.28
63 0.27
64 0.24
65 0.23
66 0.19
67 0.15
68 0.13
69 0.12
70 0.14
71 0.18
72 0.17
73 0.15
74 0.15
75 0.16
76 0.15
77 0.15
78 0.13
79 0.08
80 0.07
81 0.07
82 0.07
83 0.06
84 0.07
85 0.07
86 0.07
87 0.06
88 0.07
89 0.06
90 0.08
91 0.09
92 0.1
93 0.09
94 0.12
95 0.14
96 0.15
97 0.18
98 0.19
99 0.28
100 0.37
101 0.43
102 0.5
103 0.55
104 0.56
105 0.58
106 0.57
107 0.55
108 0.48
109 0.46
110 0.41
111 0.38
112 0.4
113 0.38
114 0.38
115 0.3
116 0.31
117 0.28
118 0.25
119 0.29
120 0.27
121 0.24
122 0.22
123 0.22
124 0.2
125 0.19
126 0.18
127 0.11
128 0.08
129 0.08
130 0.1
131 0.1
132 0.1
133 0.12
134 0.17
135 0.18
136 0.26
137 0.26
138 0.25
139 0.27
140 0.27
141 0.25
142 0.19
143 0.18
144 0.14
145 0.13
146 0.14
147 0.11
148 0.11
149 0.11
150 0.1
151 0.12
152 0.09
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.11
159 0.09
160 0.09
161 0.1
162 0.09
163 0.12
164 0.17
165 0.19
166 0.2
167 0.23
168 0.28
169 0.38
170 0.46
171 0.52