Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3S0W3

Protein Details
Accession E3S0W3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-73YIPLSPRTPKRKPSRPEPPKRAKQPPPKAPKAPTHydrophilic
NLS Segment(s)
PositionSequence
46-71RTPKRKPSRPEPPKRAKQPPPKAPKA
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 4.5, cyto 1.5
Family & Domain DBs
KEGG pte:PTT_15755  -  
Amino Acid Sequences MLVFSSPRCDSLLPRRPGKQTSFLSARLSLPFWSTQTPAYIPLSPRTPKRKPSRPEPPKRAKQPPPKAPKAPTPSTADMSHHPGTPRSLTFAPTLGSIPEVFEYDSLDAQFGSASLNDAPETPEAFLPEASSMSPPTLTRATSWPAIIQSPSRRVASPFAVSKALRKILEADRARRRRIMKVYLKAIVFLKYLWRANERYGNVMVTTGMYMQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.62
4 0.67
5 0.66
6 0.64
7 0.58
8 0.6
9 0.58
10 0.54
11 0.52
12 0.47
13 0.43
14 0.36
15 0.33
16 0.25
17 0.23
18 0.22
19 0.2
20 0.2
21 0.19
22 0.18
23 0.2
24 0.2
25 0.21
26 0.22
27 0.24
28 0.23
29 0.26
30 0.31
31 0.33
32 0.4
33 0.46
34 0.5
35 0.56
36 0.65
37 0.71
38 0.72
39 0.78
40 0.81
41 0.83
42 0.87
43 0.88
44 0.89
45 0.89
46 0.91
47 0.91
48 0.9
49 0.9
50 0.89
51 0.89
52 0.88
53 0.86
54 0.83
55 0.77
56 0.76
57 0.73
58 0.66
59 0.6
60 0.57
61 0.51
62 0.48
63 0.45
64 0.37
65 0.32
66 0.34
67 0.31
68 0.26
69 0.24
70 0.22
71 0.22
72 0.23
73 0.21
74 0.18
75 0.18
76 0.18
77 0.18
78 0.17
79 0.16
80 0.14
81 0.14
82 0.09
83 0.09
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.03
101 0.04
102 0.04
103 0.05
104 0.05
105 0.05
106 0.07
107 0.07
108 0.08
109 0.07
110 0.08
111 0.08
112 0.09
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.07
123 0.1
124 0.11
125 0.12
126 0.12
127 0.15
128 0.18
129 0.18
130 0.19
131 0.17
132 0.16
133 0.17
134 0.17
135 0.19
136 0.21
137 0.25
138 0.28
139 0.28
140 0.28
141 0.29
142 0.31
143 0.31
144 0.31
145 0.28
146 0.27
147 0.3
148 0.3
149 0.32
150 0.34
151 0.35
152 0.29
153 0.28
154 0.31
155 0.32
156 0.42
157 0.43
158 0.46
159 0.52
160 0.58
161 0.61
162 0.62
163 0.61
164 0.6
165 0.63
166 0.65
167 0.64
168 0.66
169 0.69
170 0.68
171 0.64
172 0.58
173 0.51
174 0.43
175 0.33
176 0.25
177 0.25
178 0.25
179 0.29
180 0.3
181 0.33
182 0.33
183 0.39
184 0.47
185 0.43
186 0.41
187 0.4
188 0.37
189 0.32
190 0.3
191 0.24
192 0.16
193 0.15