Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RYC4

Protein Details
Accession E3RYC4   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
463-482RAQPGTKKRRHITDYPNPHAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000286  His_deacetylse  
IPR003084  His_deacetylse_1  
IPR023801  His_deacetylse_dom  
IPR037138  His_deacetylse_dom_sf  
IPR023696  Ureohydrolase_dom_sf  
Gene Ontology GO:0034399  C:nuclear periphery  
GO:0033698  C:Rpd3L complex  
GO:0032221  C:Rpd3S/Clr6-CII complex  
GO:0070211  C:Snt2C complex  
GO:0004407  F:histone deacetylase activity  
GO:0046872  F:metal ion binding  
GO:0003713  F:transcription coactivator activity  
GO:0003714  F:transcription corepressor activity  
GO:0044804  P:autophagy of nucleus  
GO:0016575  P:histone deacetylation  
GO:0061188  P:negative regulation of rDNA heterochromatin formation  
GO:0045128  P:negative regulation of reciprocal meiotic recombination  
GO:0061186  P:negative regulation of silent mating-type cassette heterochromatin formation  
GO:0016479  P:negative regulation of transcription by RNA polymerase I  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0051038  P:negative regulation of transcription involved in meiotic cell cycle  
GO:0016239  P:positive regulation of macroautophagy  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0034503  P:protein localization to nucleolar rDNA repeats  
GO:0070550  P:rDNA chromatin condensation  
GO:0030174  P:regulation of DNA-templated DNA replication initiation  
GO:0000083  P:regulation of transcription involved in G1/S transition of mitotic cell cycle  
GO:0000117  P:regulation of transcription involved in G2/M transition of mitotic cell cycle  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG pte:PTT_14524  -  
Pfam View protein in Pfam  
PF00850  Hist_deacetyl  
Amino Acid Sequences MVEESMAPTTGSSSLNNGTATQPKKVAYFYDSDVGNYAYVAGHPMKPHRIRMAHSLIMNYGLYTKMEIYRAKPASKYEMTQFHTDEYIEFLHKVTPDNMEQFTREQSKYNVGDDCPVFDGLFEFCGISAGGTMEGAARLNRGKCDVAVNWAGGLHHAKKSEASGFCYVNDIVLGIIELLRYKQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGSGKNYSVNFPLRDGITDETYRNIFEPVIQAVMDYYGPEAIVLQCGGDSLSGDRLGCFNLSMDGHANCVKYVKSFGVPVIVLGGGGYTMRNVARTWAYETGELVGEKMAKQLPFNDYYEYFAPDYELDVRPSNMENANSHDYLHKIKSAVIENIRRTGKPSVEAFTNIPNNPIAAATRMMDSDAEDEDDDLDADENKDVRMTQRQRDKQIEHEGELYDASDDEDYKNSLGVRAQPGTKKRRHITDYPNPHAAPADEMDGLEELNGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.21
4 0.2
5 0.22
6 0.29
7 0.31
8 0.31
9 0.32
10 0.31
11 0.33
12 0.34
13 0.34
14 0.29
15 0.3
16 0.29
17 0.31
18 0.3
19 0.28
20 0.28
21 0.25
22 0.21
23 0.17
24 0.14
25 0.09
26 0.08
27 0.11
28 0.12
29 0.14
30 0.18
31 0.24
32 0.33
33 0.37
34 0.44
35 0.49
36 0.51
37 0.53
38 0.58
39 0.61
40 0.55
41 0.52
42 0.47
43 0.39
44 0.36
45 0.32
46 0.23
47 0.17
48 0.13
49 0.11
50 0.11
51 0.12
52 0.13
53 0.18
54 0.2
55 0.22
56 0.32
57 0.36
58 0.38
59 0.39
60 0.4
61 0.44
62 0.44
63 0.44
64 0.41
65 0.45
66 0.46
67 0.48
68 0.45
69 0.38
70 0.36
71 0.33
72 0.26
73 0.2
74 0.18
75 0.15
76 0.14
77 0.13
78 0.15
79 0.15
80 0.17
81 0.17
82 0.19
83 0.21
84 0.24
85 0.26
86 0.24
87 0.25
88 0.25
89 0.29
90 0.31
91 0.29
92 0.28
93 0.28
94 0.35
95 0.36
96 0.37
97 0.34
98 0.28
99 0.33
100 0.3
101 0.3
102 0.23
103 0.22
104 0.18
105 0.15
106 0.15
107 0.1
108 0.1
109 0.09
110 0.06
111 0.06
112 0.07
113 0.07
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.05
122 0.06
123 0.05
124 0.07
125 0.11
126 0.12
127 0.13
128 0.16
129 0.17
130 0.17
131 0.21
132 0.2
133 0.22
134 0.22
135 0.21
136 0.18
137 0.18
138 0.17
139 0.14
140 0.17
141 0.14
142 0.15
143 0.16
144 0.16
145 0.16
146 0.19
147 0.25
148 0.22
149 0.25
150 0.26
151 0.26
152 0.25
153 0.27
154 0.24
155 0.17
156 0.16
157 0.11
158 0.07
159 0.06
160 0.06
161 0.03
162 0.03
163 0.03
164 0.04
165 0.04
166 0.07
167 0.07
168 0.08
169 0.1
170 0.13
171 0.15
172 0.19
173 0.22
174 0.22
175 0.24
176 0.24
177 0.25
178 0.22
179 0.2
180 0.15
181 0.12
182 0.1
183 0.07
184 0.07
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.04
192 0.05
193 0.05
194 0.05
195 0.06
196 0.07
197 0.11
198 0.13
199 0.15
200 0.14
201 0.15
202 0.15
203 0.15
204 0.18
205 0.16
206 0.13
207 0.12
208 0.16
209 0.16
210 0.15
211 0.15
212 0.11
213 0.09
214 0.09
215 0.09
216 0.05
217 0.06
218 0.06
219 0.07
220 0.07
221 0.07
222 0.08
223 0.08
224 0.1
225 0.11
226 0.15
227 0.15
228 0.15
229 0.16
230 0.15
231 0.15
232 0.16
233 0.14
234 0.13
235 0.14
236 0.13
237 0.13
238 0.13
239 0.13
240 0.11
241 0.1
242 0.08
243 0.07
244 0.08
245 0.07
246 0.08
247 0.07
248 0.07
249 0.06
250 0.07
251 0.06
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.03
259 0.04
260 0.04
261 0.04
262 0.03
263 0.04
264 0.04
265 0.03
266 0.03
267 0.04
268 0.05
269 0.06
270 0.06
271 0.06
272 0.07
273 0.07
274 0.07
275 0.07
276 0.05
277 0.07
278 0.07
279 0.08
280 0.09
281 0.09
282 0.11
283 0.13
284 0.13
285 0.11
286 0.12
287 0.11
288 0.1
289 0.12
290 0.12
291 0.11
292 0.12
293 0.12
294 0.14
295 0.13
296 0.12
297 0.11
298 0.09
299 0.08
300 0.07
301 0.06
302 0.03
303 0.04
304 0.04
305 0.03
306 0.04
307 0.04
308 0.06
309 0.06
310 0.09
311 0.1
312 0.12
313 0.16
314 0.19
315 0.2
316 0.19
317 0.2
318 0.18
319 0.18
320 0.16
321 0.12
322 0.09
323 0.09
324 0.08
325 0.11
326 0.12
327 0.12
328 0.13
329 0.16
330 0.19
331 0.22
332 0.23
333 0.24
334 0.22
335 0.25
336 0.25
337 0.24
338 0.2
339 0.17
340 0.16
341 0.13
342 0.14
343 0.15
344 0.15
345 0.15
346 0.16
347 0.17
348 0.17
349 0.18
350 0.19
351 0.18
352 0.19
353 0.17
354 0.22
355 0.27
356 0.25
357 0.25
358 0.23
359 0.23
360 0.25
361 0.26
362 0.22
363 0.18
364 0.2
365 0.25
366 0.27
367 0.31
368 0.35
369 0.4
370 0.4
371 0.47
372 0.47
373 0.42
374 0.42
375 0.41
376 0.36
377 0.35
378 0.35
379 0.31
380 0.31
381 0.33
382 0.31
383 0.33
384 0.36
385 0.3
386 0.29
387 0.26
388 0.24
389 0.21
390 0.21
391 0.14
392 0.1
393 0.12
394 0.11
395 0.12
396 0.12
397 0.12
398 0.11
399 0.11
400 0.11
401 0.11
402 0.11
403 0.1
404 0.1
405 0.1
406 0.1
407 0.09
408 0.08
409 0.08
410 0.07
411 0.08
412 0.1
413 0.1
414 0.1
415 0.1
416 0.11
417 0.14
418 0.24
419 0.3
420 0.37
421 0.48
422 0.56
423 0.64
424 0.72
425 0.72
426 0.7
427 0.75
428 0.71
429 0.62
430 0.57
431 0.49
432 0.4
433 0.37
434 0.28
435 0.17
436 0.13
437 0.11
438 0.09
439 0.09
440 0.1
441 0.11
442 0.12
443 0.12
444 0.14
445 0.13
446 0.15
447 0.17
448 0.22
449 0.26
450 0.29
451 0.35
452 0.41
453 0.5
454 0.58
455 0.63
456 0.67
457 0.68
458 0.74
459 0.75
460 0.77
461 0.79
462 0.8
463 0.83
464 0.8
465 0.8
466 0.7
467 0.63
468 0.55
469 0.45
470 0.38
471 0.29
472 0.25
473 0.18
474 0.18
475 0.18
476 0.16
477 0.15