FuNGI

E3RYC4

Protein Details

Accession

E3RYC4

Localization Confidence

Low

Confidence Score

9.4

NoLS Segment(s)

Position	Sequence	Protein Nature
463-482	RAQPGTKKRRHITDYPNPHA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 17, cyto_nucl 13.5, cyto 8

Family & Domain DBs

InterPro	View protein in InterPro IPR000286 His_deacetylse IPR003084 His_deacetylse_1 IPR023801 His_deacetylse_dom IPR037138 His_deacetylse_dom_sf IPR023696 Ureohydrolase_dom_sf
Gene Ontology	GO:0034399 C:nuclear periphery GO:0033698 C:Rpd3L complex GO:0032221 C:Rpd3S/Clr6-CII complex GO:0070211 C:Snt2C complex GO:0004407 F:histone deacetylase activity GO:0046872 F:metal ion binding GO:0003713 F:transcription coactivator activity GO:0003714 F:transcription corepressor activity GO:0044804 P:autophagy of nucleus GO:0016575 P:histone deacetylation GO:0061188 P:negative regulation of rDNA heterochromatin formation GO:0045128 P:negative regulation of reciprocal meiotic recombination GO:0061186 P:negative regulation of silent mating-type cassette heterochromatin formation GO:0016479 P:negative regulation of transcription by RNA polymerase I GO:0000122 P:negative regulation of transcription by RNA polymerase II GO:0051038 P:negative regulation of transcription involved in meiotic cell cycle GO:0016239 P:positive regulation of macroautophagy GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0034503 P:protein localization to nucleolar rDNA repeats GO:0070550 P:rDNA chromatin condensation GO:0030174 P:regulation of DNA-templated DNA replication initiation GO:0000083 P:regulation of transcription involved in G1/S transition of mitotic cell cycle GO:0000117 P:regulation of transcription involved in G2/M transition of mitotic cell cycle GO:0006368 P:transcription elongation by RNA polymerase II
KEGG	pte:PTT_14524 -
Pfam	View protein in Pfam PF00850 Hist_deacetyl

Amino Acid Sequences

MVEESMAPTTGSSSLNNGTATQPKKVAYFYDSDVGNYAYVAGHPMKPHRIRMAHSLIMNYGLYTKMEIYRAKPASKYEMTQFHTDEYIEFLHKVTPDNMEQFTREQSKYNVGDDCPVFDGLFEFCGISAGGTMEGAARLNRGKCDVAVNWAGGLHHAKKSEASGFCYVNDIVLGIIELLRYKQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGSGKNYSVNFPLRDGITDETYRNIFEPVIQAVMDYYGPEAIVLQCGGDSLSGDRLGCFNLSMDGHANCVKYVKSFGVPVIVLGGGGYTMRNVARTWAYETGELVGEKMAKQLPFNDYYEYFAPDYELDVRPSNMENANSHDYLHKIKSAVIENIRRTGKPSVEAFTNIPNNPIAAATRMMDSDAEDEDDDLDADENKDVRMTQRQRDKQIEHEGELYDASDDEDYKNSLGVRAQPGTKKRRHITDYPNPHAAPADEMDGLEELNGE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.2
3	0.21
4	0.2
5	0.22
6	0.29
7	0.31
8	0.31
9	0.32
10	0.31
11	0.33
12	0.34
13	0.34
14	0.29
15	0.3
16	0.29
17	0.31
18	0.3
19	0.28
20	0.28
21	0.25
22	0.21
23	0.17
24	0.14
25	0.09
26	0.08
27	0.11
28	0.12
29	0.14
30	0.18
31	0.24
32	0.33
33	0.37
34	0.44
35	0.49
36	0.51
37	0.53
38	0.58
39	0.61
40	0.55
41	0.52
42	0.47
43	0.39
44	0.36
45	0.32
46	0.23
47	0.17
48	0.13
49	0.11
50	0.11
51	0.12
52	0.13
53	0.18
54	0.2
55	0.22
56	0.32
57	0.36
58	0.38
59	0.39
60	0.4
61	0.44
62	0.44
63	0.44
64	0.41
65	0.45
66	0.46
67	0.48
68	0.45
69	0.38
70	0.36
71	0.33
72	0.26
73	0.2
74	0.18
75	0.15
76	0.14
77	0.13
78	0.15
79	0.15
80	0.17
81	0.17
82	0.19
83	0.21
84	0.24
85	0.26
86	0.24
87	0.25
88	0.25
89	0.29
90	0.31
91	0.29
92	0.28
93	0.28
94	0.35
95	0.36
96	0.37
97	0.34
98	0.28
99	0.33
100	0.3
101	0.3
102	0.23
103	0.22
104	0.18
105	0.15
106	0.15
107	0.1
108	0.1
109	0.09
110	0.06
111	0.06
112	0.07
113	0.07
114	0.05
115	0.05
116	0.05
117	0.05
118	0.05
119	0.05
120	0.04
121	0.05
122	0.06
123	0.05
124	0.07
125	0.11
126	0.12
127	0.13
128	0.16
129	0.17
130	0.17
131	0.21
132	0.2
133	0.22
134	0.22
135	0.21
136	0.18
137	0.18
138	0.17
139	0.14
140	0.17
141	0.14
142	0.15
143	0.16
144	0.16
145	0.16
146	0.19
147	0.25
148	0.22
149	0.25
150	0.26
151	0.26
152	0.25
153	0.27
154	0.24
155	0.17
156	0.16
157	0.11
158	0.07
159	0.06
160	0.06
161	0.03
162	0.03
163	0.03
164	0.04
165	0.04
166	0.07
167	0.07
168	0.08
169	0.1
170	0.13
171	0.15
172	0.19
173	0.22
174	0.22
175	0.24
176	0.24
177	0.25
178	0.22
179	0.2
180	0.15
181	0.12
182	0.1
183	0.07
184	0.07
185	0.04
186	0.04
187	0.04
188	0.04
189	0.04
190	0.05
191	0.04
192	0.05
193	0.05
194	0.05
195	0.06
196	0.07
197	0.11
198	0.13
199	0.15
200	0.14
201	0.15
202	0.15
203	0.15
204	0.18
205	0.16
206	0.13
207	0.12
208	0.16
209	0.16
210	0.15
211	0.15
212	0.11
213	0.09
214	0.09
215	0.09
216	0.05
217	0.06
218	0.06
219	0.07
220	0.07
221	0.07
222	0.08
223	0.08
224	0.1
225	0.11
226	0.15
227	0.15
228	0.15
229	0.16
230	0.15
231	0.15
232	0.16
233	0.14
234	0.13
235	0.14
236	0.13
237	0.13
238	0.13
239	0.13
240	0.11
241	0.1
242	0.08
243	0.07
244	0.08
245	0.07
246	0.08
247	0.07
248	0.07
249	0.06
250	0.07
251	0.06
252	0.04
253	0.04
254	0.04
255	0.04
256	0.04
257	0.04
258	0.03
259	0.04
260	0.04
261	0.04
262	0.03
263	0.04
264	0.04
265	0.03
266	0.03
267	0.04
268	0.05
269	0.06
270	0.06
271	0.06
272	0.07
273	0.07
274	0.07
275	0.07
276	0.05
277	0.07
278	0.07
279	0.08
280	0.09
281	0.09
282	0.11
283	0.13
284	0.13
285	0.11
286	0.12
287	0.11
288	0.1
289	0.12
290	0.12
291	0.11
292	0.12
293	0.12
294	0.14
295	0.13
296	0.12
297	0.11
298	0.09
299	0.08
300	0.07
301	0.06
302	0.03
303	0.04
304	0.04
305	0.03
306	0.04
307	0.04
308	0.06
309	0.06
310	0.09
311	0.1
312	0.12
313	0.16
314	0.19
315	0.2
316	0.19
317	0.2
318	0.18
319	0.18
320	0.16
321	0.12
322	0.09
323	0.09
324	0.08
325	0.11
326	0.12
327	0.12
328	0.13
329	0.16
330	0.19
331	0.22
332	0.23
333	0.24
334	0.22
335	0.25
336	0.25
337	0.24
338	0.2
339	0.17
340	0.16
341	0.13
342	0.14
343	0.15
344	0.15
345	0.15
346	0.16
347	0.17
348	0.17
349	0.18
350	0.19
351	0.18
352	0.19
353	0.17
354	0.22
355	0.27
356	0.25
357	0.25
358	0.23
359	0.23
360	0.25
361	0.26
362	0.22
363	0.18
364	0.2
365	0.25
366	0.27
367	0.31
368	0.35
369	0.4
370	0.4
371	0.47
372	0.47
373	0.42
374	0.42
375	0.41
376	0.36
377	0.35
378	0.35
379	0.31
380	0.31
381	0.33
382	0.31
383	0.33
384	0.36
385	0.3
386	0.29
387	0.26
388	0.24
389	0.21
390	0.21
391	0.14
392	0.1
393	0.12
394	0.11
395	0.12
396	0.12
397	0.12
398	0.11
399	0.11
400	0.11
401	0.11
402	0.11
403	0.1
404	0.1
405	0.1
406	0.1
407	0.09
408	0.08
409	0.08
410	0.07
411	0.08
412	0.1
413	0.1
414	0.1
415	0.1
416	0.11
417	0.14
418	0.24
419	0.3
420	0.37
421	0.48
422	0.56
423	0.64
424	0.72
425	0.72
426	0.7
427	0.75
428	0.71
429	0.62
430	0.57
431	0.49
432	0.4
433	0.37
434	0.28
435	0.17
436	0.13
437	0.11
438	0.09
439	0.09
440	0.1
441	0.11
442	0.12
443	0.12
444	0.14
445	0.13
446	0.15
447	0.17
448	0.22
449	0.26
450	0.29
451	0.35
452	0.41
453	0.5
454	0.58
455	0.63
456	0.67
457	0.68
458	0.74
459	0.75
460	0.77
461	0.79
462	0.8
463	0.83
464	0.8
465	0.8
466	0.7
467	0.63
468	0.55
469	0.45
470	0.38
471	0.29
472	0.25
473	0.18
474	0.18
475	0.18
476	0.16
477	0.15

E3RYC4

3D AlphaFold-predicted Structure Viewer