Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3RDA7

Protein Details
Accession E3RDA7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-81DASIKNRCLHCRQRLKRNRLTPFPAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
KEGG pte:PTT_01919  -  
Amino Acid Sequences MRLILWRSERARPDSLLTTTSSNEDIKYRQRAASGRAFDVQTNSSHPARGRNSSIDASIKNRCLHCRQRLKRNRLTPFPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.35
4 0.31
5 0.27
6 0.24
7 0.23
8 0.21
9 0.17
10 0.16
11 0.16
12 0.18
13 0.22
14 0.28
15 0.28
16 0.27
17 0.3
18 0.32
19 0.35
20 0.39
21 0.34
22 0.3
23 0.3
24 0.29
25 0.26
26 0.25
27 0.21
28 0.14
29 0.15
30 0.17
31 0.15
32 0.16
33 0.17
34 0.22
35 0.25
36 0.28
37 0.28
38 0.28
39 0.31
40 0.3
41 0.32
42 0.28
43 0.26
44 0.26
45 0.28
46 0.3
47 0.31
48 0.32
49 0.36
50 0.42
51 0.5
52 0.56
53 0.62
54 0.67
55 0.74
56 0.82
57 0.87
58 0.88
59 0.89
60 0.88
61 0.86