Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A7J6J380

Protein Details
Accession A0A7J6J380   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
255-279HPVQERGRRGKDKSAPKNRGPFWRGBasic
NLS Segment(s)
PositionSequence
260-275RGRRGKDKSAPKNRGP
Subcellular Location(s) cyto 12.5, cyto_nucl 11.833, cyto_mito 9.666, nucl 9, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045030  LYSM1-4  
IPR018392  LysM_dom  
IPR036779  LysM_dom_sf  
CDD cd00118  LysM  
Amino Acid Sequences MKIERTLATEKERQPMDNSACCTCAKLLTSVPRYHPATEKPLPDDRVLECCARIICGSCIHDNPRFASYCPYCQTSSNPATSVLPPNLKDPPAYTSVARSNLHVSGPSAPPPPYTATTNVPVDDEKAGSSATATPPEDTLHFLNHEHDTVASLSLRYGVPAAVLRRANNITSDHLLQGRKTVLIPGEYYAAGISLSPRPIEGEEEELRKSKIRRFMTGCKVSDYDVAVLYLEQAGYDLEEAMEAFAADEVWERDHPVQERGRRGKDKSAPKNRGPFWRGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.5
4 0.48
5 0.48
6 0.41
7 0.41
8 0.39
9 0.37
10 0.29
11 0.26
12 0.21
13 0.21
14 0.25
15 0.32
16 0.39
17 0.41
18 0.45
19 0.49
20 0.5
21 0.5
22 0.5
23 0.45
24 0.48
25 0.49
26 0.49
27 0.47
28 0.51
29 0.51
30 0.47
31 0.45
32 0.38
33 0.37
34 0.36
35 0.31
36 0.24
37 0.24
38 0.22
39 0.2
40 0.19
41 0.16
42 0.15
43 0.19
44 0.22
45 0.23
46 0.26
47 0.3
48 0.33
49 0.33
50 0.33
51 0.32
52 0.3
53 0.28
54 0.33
55 0.32
56 0.34
57 0.35
58 0.36
59 0.33
60 0.33
61 0.37
62 0.36
63 0.37
64 0.33
65 0.3
66 0.28
67 0.29
68 0.3
69 0.3
70 0.26
71 0.25
72 0.24
73 0.26
74 0.28
75 0.27
76 0.24
77 0.21
78 0.21
79 0.21
80 0.22
81 0.19
82 0.2
83 0.23
84 0.28
85 0.27
86 0.25
87 0.24
88 0.23
89 0.23
90 0.19
91 0.17
92 0.15
93 0.16
94 0.18
95 0.17
96 0.16
97 0.16
98 0.18
99 0.2
100 0.18
101 0.19
102 0.2
103 0.2
104 0.24
105 0.24
106 0.22
107 0.2
108 0.18
109 0.17
110 0.14
111 0.12
112 0.08
113 0.08
114 0.07
115 0.06
116 0.07
117 0.07
118 0.07
119 0.09
120 0.09
121 0.09
122 0.1
123 0.11
124 0.11
125 0.12
126 0.11
127 0.1
128 0.11
129 0.11
130 0.12
131 0.12
132 0.12
133 0.1
134 0.09
135 0.09
136 0.09
137 0.09
138 0.07
139 0.06
140 0.06
141 0.07
142 0.07
143 0.06
144 0.06
145 0.05
146 0.06
147 0.08
148 0.09
149 0.12
150 0.14
151 0.14
152 0.18
153 0.19
154 0.19
155 0.18
156 0.19
157 0.17
158 0.19
159 0.19
160 0.17
161 0.2
162 0.2
163 0.18
164 0.19
165 0.17
166 0.15
167 0.14
168 0.15
169 0.12
170 0.13
171 0.14
172 0.12
173 0.13
174 0.12
175 0.12
176 0.09
177 0.08
178 0.07
179 0.06
180 0.07
181 0.08
182 0.08
183 0.08
184 0.09
185 0.1
186 0.11
187 0.13
188 0.13
189 0.17
190 0.19
191 0.21
192 0.23
193 0.23
194 0.24
195 0.26
196 0.28
197 0.27
198 0.34
199 0.36
200 0.43
201 0.49
202 0.57
203 0.63
204 0.69
205 0.64
206 0.59
207 0.55
208 0.49
209 0.44
210 0.36
211 0.26
212 0.18
213 0.17
214 0.13
215 0.12
216 0.11
217 0.09
218 0.07
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.04
226 0.05
227 0.05
228 0.05
229 0.05
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.06
236 0.07
237 0.1
238 0.1
239 0.13
240 0.16
241 0.22
242 0.24
243 0.3
244 0.37
245 0.42
246 0.52
247 0.58
248 0.66
249 0.68
250 0.7
251 0.74
252 0.75
253 0.79
254 0.79
255 0.81
256 0.81
257 0.81
258 0.86
259 0.83
260 0.84
261 0.78