Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A7J6IBX3

Protein Details
Accession A0A7J6IBX3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-82GSVAAGPSKKRKRRNADDDDSDYKHydrophilic
NLS Segment(s)
PositionSequence
66-72SKKRKRR
Subcellular Location(s) mito 9cyto_nucl 9, nucl 8.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MYKVRAGAVEKWKLSKRVDLDVVAAYWAKMSARIGLTERAWLARLRFTFRVQLAQFRLGSVAAGPSKKRKRRNADDDDSDYKPPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.45
4 0.45
5 0.46
6 0.4
7 0.37
8 0.32
9 0.3
10 0.23
11 0.2
12 0.12
13 0.09
14 0.08
15 0.06
16 0.06
17 0.07
18 0.09
19 0.1
20 0.11
21 0.13
22 0.15
23 0.15
24 0.16
25 0.15
26 0.12
27 0.13
28 0.13
29 0.12
30 0.13
31 0.14
32 0.17
33 0.19
34 0.2
35 0.24
36 0.24
37 0.3
38 0.27
39 0.31
40 0.29
41 0.31
42 0.29
43 0.25
44 0.25
45 0.18
46 0.17
47 0.11
48 0.12
49 0.11
50 0.13
51 0.15
52 0.25
53 0.36
54 0.44
55 0.54
56 0.61
57 0.69
58 0.78
59 0.87
60 0.87
61 0.87
62 0.87
63 0.84
64 0.8
65 0.72
66 0.62