Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A7J6J552

Protein Details
Accession A0A7J6J552    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-87GASANSKKEKKKRKETVTSPSSTHydrophilic
NLS Segment(s)
PositionSequence
71-78KKEKKKRK
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MFSKEIRAAAIEAIKAATQRRREEMVAKVGRQLYALSAAQNRTNLNSSVASLNAVHGGEQDADYGASANSKKEKKKRKETVTSPSSTDQQTTDDASVIGELLDPETDSMCPCMGKRERERVWVYPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.18
4 0.22
5 0.27
6 0.31
7 0.35
8 0.39
9 0.4
10 0.43
11 0.44
12 0.48
13 0.46
14 0.42
15 0.42
16 0.39
17 0.37
18 0.33
19 0.27
20 0.18
21 0.17
22 0.17
23 0.14
24 0.16
25 0.17
26 0.18
27 0.2
28 0.19
29 0.17
30 0.19
31 0.18
32 0.17
33 0.16
34 0.15
35 0.14
36 0.14
37 0.12
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.06
44 0.07
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.06
55 0.07
56 0.13
57 0.18
58 0.26
59 0.34
60 0.45
61 0.54
62 0.65
63 0.74
64 0.78
65 0.84
66 0.84
67 0.86
68 0.82
69 0.74
70 0.66
71 0.58
72 0.51
73 0.41
74 0.34
75 0.25
76 0.19
77 0.19
78 0.17
79 0.16
80 0.13
81 0.12
82 0.11
83 0.1
84 0.08
85 0.07
86 0.05
87 0.04
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.07
94 0.07
95 0.08
96 0.09
97 0.1
98 0.1
99 0.2
100 0.25
101 0.35
102 0.43
103 0.52
104 0.56
105 0.64
106 0.7