Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A7J6IKH6

Protein Details
Accession A0A7J6IKH6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-25GYRQKFRVTRSWHTHRFRRGLRRABasic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 6, cyto_mito 6, E.R. 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGYRQKFRVTRSWHTHRFRRGLRRALVILTVIDLTRFIVIFSLLHAARKADRAGFPTPRSRGEDIIGMADRPNDVELEEVQRCMTVPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.8
4 0.81
5 0.79
6 0.8
7 0.79
8 0.78
9 0.73
10 0.7
11 0.62
12 0.54
13 0.46
14 0.36
15 0.27
16 0.18
17 0.15
18 0.09
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.08
30 0.07
31 0.08
32 0.08
33 0.09
34 0.1
35 0.12
36 0.12
37 0.11
38 0.13
39 0.16
40 0.21
41 0.25
42 0.28
43 0.33
44 0.35
45 0.36
46 0.4
47 0.38
48 0.35
49 0.32
50 0.32
51 0.25
52 0.26
53 0.23
54 0.18
55 0.16
56 0.15
57 0.13
58 0.11
59 0.11
60 0.07
61 0.07
62 0.09
63 0.1
64 0.16
65 0.17
66 0.17
67 0.16
68 0.16