Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A7J6IGZ2

Protein Details
Accession A0A7J6IGZ2    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
60-83SKNEPKKGEPEKKSESKKKNETEDBasic
NLS Segment(s)
PositionSequence
63-78EPKKGEPEKKSESKKK
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MPSSKGKPTDPELREEIKEEIKQEPNKSGGGEGQWSAWKASKLAKEYEKQGGDYENEAGSKNEPKKGEPEKKSESKKKNETED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.4
4 0.35
5 0.35
6 0.31
7 0.32
8 0.35
9 0.39
10 0.39
11 0.39
12 0.36
13 0.35
14 0.33
15 0.28
16 0.21
17 0.17
18 0.16
19 0.13
20 0.12
21 0.12
22 0.12
23 0.12
24 0.13
25 0.12
26 0.11
27 0.16
28 0.19
29 0.2
30 0.24
31 0.27
32 0.28
33 0.31
34 0.37
35 0.33
36 0.3
37 0.28
38 0.26
39 0.23
40 0.22
41 0.19
42 0.13
43 0.13
44 0.13
45 0.13
46 0.13
47 0.19
48 0.22
49 0.26
50 0.26
51 0.28
52 0.36
53 0.46
54 0.55
55 0.53
56 0.58
57 0.62
58 0.7
59 0.79
60 0.81
61 0.8
62 0.8
63 0.84