Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A7J6JNE4

Protein Details
Accession A0A7J6JNE4    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-84QSALRRYSKAPKRDRKNVQNWHFNHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, vacu 3, nucl 1, cyto 1, cyto_nucl 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046529  DUF6594  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20237  DUF6594  
Amino Acid Sequences MQDEIAQLEEELQDVDKGTMAANAPDFNNGTLRGDIEGRSTLIKAISEKLRHYNELILQQSALRRYSKAPKRDRKNVQNWHFNHDYAAIAHEEQAYLEKEDLVSVAYTEKTPLRKAIDSSLRLRTLPVWRHRENTAPSYDAREVTYYSDKRMNAFASAVIIAIGVVMLLTPIWILQAMGDLKGKLAVITVFIFIFLLVLSLAMVAKPFEALGATAAYAAVLMVFIQLGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.08
5 0.08
6 0.1
7 0.1
8 0.12
9 0.12
10 0.14
11 0.14
12 0.16
13 0.17
14 0.15
15 0.17
16 0.16
17 0.17
18 0.15
19 0.16
20 0.15
21 0.15
22 0.15
23 0.15
24 0.15
25 0.14
26 0.14
27 0.14
28 0.13
29 0.13
30 0.14
31 0.13
32 0.17
33 0.23
34 0.25
35 0.28
36 0.35
37 0.38
38 0.38
39 0.38
40 0.37
41 0.34
42 0.38
43 0.37
44 0.29
45 0.25
46 0.25
47 0.27
48 0.25
49 0.23
50 0.17
51 0.17
52 0.22
53 0.32
54 0.39
55 0.46
56 0.54
57 0.62
58 0.7
59 0.8
60 0.85
61 0.85
62 0.88
63 0.88
64 0.86
65 0.85
66 0.77
67 0.73
68 0.65
69 0.54
70 0.44
71 0.35
72 0.27
73 0.17
74 0.17
75 0.11
76 0.09
77 0.09
78 0.08
79 0.07
80 0.07
81 0.09
82 0.08
83 0.08
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.05
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.07
96 0.09
97 0.1
98 0.11
99 0.14
100 0.17
101 0.18
102 0.19
103 0.24
104 0.29
105 0.31
106 0.33
107 0.35
108 0.32
109 0.31
110 0.3
111 0.27
112 0.28
113 0.32
114 0.37
115 0.4
116 0.41
117 0.44
118 0.45
119 0.48
120 0.45
121 0.41
122 0.35
123 0.29
124 0.28
125 0.3
126 0.29
127 0.24
128 0.21
129 0.17
130 0.16
131 0.17
132 0.25
133 0.2
134 0.22
135 0.26
136 0.26
137 0.26
138 0.28
139 0.26
140 0.19
141 0.19
142 0.16
143 0.12
144 0.12
145 0.1
146 0.08
147 0.06
148 0.05
149 0.04
150 0.04
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.03
161 0.03
162 0.03
163 0.07
164 0.08
165 0.1
166 0.11
167 0.11
168 0.11
169 0.12
170 0.12
171 0.08
172 0.09
173 0.07
174 0.08
175 0.09
176 0.1
177 0.09
178 0.09
179 0.09
180 0.07
181 0.07
182 0.05
183 0.04
184 0.03
185 0.03
186 0.03
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.06
198 0.07
199 0.07
200 0.07
201 0.07
202 0.07
203 0.06
204 0.06
205 0.05
206 0.04
207 0.03
208 0.03
209 0.03