Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A7J6IP43

Protein Details
Accession A0A7J6IP43    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-76RAQHNKSRAKEKQRRGREVDBasic
NLS Segment(s)
PositionSequence
64-71RAKEKQRR
Subcellular Location(s) nucl 14cyto_nucl 14, cyto 10
Family & Domain DBs
Amino Acid Sequences MDNFRSEAILQERLTLQPDVSHGLFQNGRISTPNPVGELAYNSMTAVENPISLISSRAQHNKSRAKEKQRRGREVDEMVAYFGHKGTPPNEVLPAVTIEAPATYGGSNIYGIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.19
4 0.15
5 0.16
6 0.18
7 0.17
8 0.18
9 0.15
10 0.19
11 0.2
12 0.19
13 0.24
14 0.19
15 0.19
16 0.2
17 0.21
18 0.2
19 0.23
20 0.23
21 0.18
22 0.18
23 0.18
24 0.16
25 0.17
26 0.15
27 0.12
28 0.11
29 0.1
30 0.1
31 0.09
32 0.09
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.09
43 0.11
44 0.17
45 0.2
46 0.23
47 0.31
48 0.38
49 0.42
50 0.5
51 0.55
52 0.61
53 0.68
54 0.74
55 0.77
56 0.79
57 0.82
58 0.78
59 0.76
60 0.71
61 0.64
62 0.57
63 0.48
64 0.38
65 0.3
66 0.24
67 0.19
68 0.13
69 0.1
70 0.08
71 0.08
72 0.1
73 0.11
74 0.15
75 0.17
76 0.19
77 0.21
78 0.2
79 0.19
80 0.18
81 0.18
82 0.14
83 0.12
84 0.11
85 0.09
86 0.09
87 0.09
88 0.08
89 0.07
90 0.06
91 0.06
92 0.07
93 0.08