Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A7J6IU13

Protein Details
Accession A0A7J6IU13    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-67RPPNSEPKRSPKRLARPRSNFTPSHydrophilic
NLS Segment(s)
PositionSequence
45-61PPNSEPKRSPKRLARPR
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MGEADETTQHIHLEVRAAELHAGAVFSTIGSVFSRKHGGCRSSRPPNSEPKRSPKRLARPRSNFTPSATARLRGSDASMPAIPPITDSHGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.14
5 0.13
6 0.12
7 0.12
8 0.08
9 0.08
10 0.05
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.07
19 0.07
20 0.09
21 0.15
22 0.15
23 0.2
24 0.24
25 0.28
26 0.31
27 0.39
28 0.45
29 0.5
30 0.53
31 0.54
32 0.52
33 0.59
34 0.61
35 0.62
36 0.6
37 0.6
38 0.67
39 0.66
40 0.71
41 0.7
42 0.74
43 0.75
44 0.8
45 0.81
46 0.79
47 0.8
48 0.81
49 0.77
50 0.68
51 0.6
52 0.59
53 0.49
54 0.48
55 0.43
56 0.37
57 0.32
58 0.33
59 0.31
60 0.23
61 0.25
62 0.21
63 0.2
64 0.22
65 0.22
66 0.2
67 0.19
68 0.19
69 0.16
70 0.14
71 0.15