Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2FK27

Protein Details
Accession L2FK27   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
256-282DNKENGSSKKTKKGPKKGDKVSWQWGNHydrophilic
NLS Segment(s)
PositionSequence
201-223KRKKSGEENGSNKKRQTRQGEGK
263-273SKKTKKGPKKG
Subcellular Location(s) nucl 13.5, cyto_nucl 10.333, mito 6, cyto 6, cyto_pero 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR021487  DUF3140  
IPR021331  Hva1_TUDOR  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF11338  DUF3140  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MKGKEDVISEFNEYVNMTAEELESWLKSGDSNSAGWPKDDAEGDGETVGHDSGRNIVEILKANPDKKEEEYTDDQVEHMRKVVAYCKRHLAQEAKGNSEKSPEEVKKTKSYASLKNWGHDFLKAQGKEGSEQNGKSAKNKNGDGEKAESNGSKKDESNGSKKEKNGSKKEDDEEEEEEAEKANEGKEEEEEGVDDEKTGDKRKKSGEENGSNKKRQTRQGEGKATKKDEGGEDEKEEEEAEDDGDEEMEDDEEEGDNKENGSSKKTKKGPKKGDKVSWQWGNGNPEGKVLDVKEEKTTIETKNGNEVSRDGNPDDPAVVLDTGKSKAIKSNHELN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.11
5 0.11
6 0.11
7 0.1
8 0.12
9 0.12
10 0.09
11 0.1
12 0.1
13 0.09
14 0.1
15 0.1
16 0.14
17 0.15
18 0.16
19 0.2
20 0.26
21 0.27
22 0.27
23 0.27
24 0.23
25 0.24
26 0.24
27 0.2
28 0.17
29 0.17
30 0.17
31 0.16
32 0.14
33 0.11
34 0.11
35 0.1
36 0.07
37 0.07
38 0.06
39 0.1
40 0.11
41 0.11
42 0.11
43 0.12
44 0.15
45 0.18
46 0.19
47 0.23
48 0.27
49 0.29
50 0.31
51 0.33
52 0.33
53 0.34
54 0.39
55 0.33
56 0.36
57 0.4
58 0.41
59 0.4
60 0.37
61 0.34
62 0.31
63 0.31
64 0.24
65 0.2
66 0.17
67 0.15
68 0.16
69 0.24
70 0.28
71 0.3
72 0.33
73 0.39
74 0.4
75 0.42
76 0.46
77 0.43
78 0.41
79 0.45
80 0.45
81 0.43
82 0.44
83 0.43
84 0.38
85 0.37
86 0.31
87 0.26
88 0.32
89 0.28
90 0.33
91 0.38
92 0.42
93 0.45
94 0.46
95 0.46
96 0.45
97 0.49
98 0.5
99 0.51
100 0.56
101 0.51
102 0.52
103 0.51
104 0.45
105 0.4
106 0.32
107 0.27
108 0.23
109 0.3
110 0.26
111 0.27
112 0.27
113 0.27
114 0.28
115 0.28
116 0.28
117 0.23
118 0.23
119 0.25
120 0.27
121 0.27
122 0.3
123 0.36
124 0.36
125 0.38
126 0.39
127 0.41
128 0.41
129 0.42
130 0.39
131 0.35
132 0.3
133 0.26
134 0.25
135 0.22
136 0.18
137 0.19
138 0.18
139 0.16
140 0.16
141 0.18
142 0.24
143 0.27
144 0.33
145 0.37
146 0.41
147 0.43
148 0.44
149 0.49
150 0.49
151 0.54
152 0.55
153 0.55
154 0.54
155 0.55
156 0.56
157 0.51
158 0.47
159 0.41
160 0.34
161 0.28
162 0.23
163 0.19
164 0.17
165 0.13
166 0.11
167 0.08
168 0.06
169 0.05
170 0.06
171 0.06
172 0.06
173 0.07
174 0.08
175 0.09
176 0.08
177 0.08
178 0.08
179 0.09
180 0.08
181 0.07
182 0.06
183 0.08
184 0.1
185 0.16
186 0.2
187 0.21
188 0.26
189 0.31
190 0.38
191 0.41
192 0.49
193 0.53
194 0.58
195 0.64
196 0.7
197 0.72
198 0.68
199 0.66
200 0.64
201 0.6
202 0.6
203 0.6
204 0.6
205 0.63
206 0.7
207 0.77
208 0.75
209 0.76
210 0.74
211 0.69
212 0.6
213 0.5
214 0.42
215 0.34
216 0.34
217 0.31
218 0.27
219 0.26
220 0.25
221 0.24
222 0.23
223 0.2
224 0.14
225 0.11
226 0.09
227 0.07
228 0.06
229 0.06
230 0.06
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.04
238 0.05
239 0.05
240 0.06
241 0.07
242 0.08
243 0.08
244 0.08
245 0.09
246 0.14
247 0.15
248 0.21
249 0.29
250 0.33
251 0.43
252 0.51
253 0.6
254 0.66
255 0.76
256 0.81
257 0.83
258 0.88
259 0.88
260 0.89
261 0.89
262 0.86
263 0.84
264 0.79
265 0.72
266 0.65
267 0.61
268 0.57
269 0.52
270 0.48
271 0.38
272 0.33
273 0.31
274 0.27
275 0.24
276 0.19
277 0.23
278 0.23
279 0.25
280 0.26
281 0.27
282 0.27
283 0.27
284 0.31
285 0.25
286 0.3
287 0.32
288 0.3
289 0.39
290 0.42
291 0.39
292 0.37
293 0.36
294 0.34
295 0.35
296 0.38
297 0.3
298 0.3
299 0.3
300 0.29
301 0.28
302 0.22
303 0.18
304 0.16
305 0.15
306 0.11
307 0.12
308 0.14
309 0.15
310 0.18
311 0.18
312 0.17
313 0.24
314 0.3
315 0.37