Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A7J6JDB3

Protein Details
Accession A0A7J6JDB3   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-41ESQDVKPKKPFIRFTKRKRHSSPFVIPDHydrophilic
NLS Segment(s)
PositionSequence
21-32KKPFIRFTKRKR
85-92KNKPSRAK
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 12.499, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRPMPKTAPSSFSESQDVKPKKPFIRFTKRKRHSSPFVIPDGSQVISLPSSPEPPVEEDYAKDEIDDDYQEKSSSLPHGSGWVKKNKPSRAKSMPPARTTANATAGRRSIPPSSMPARTNTKSRGQRKSMTRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.45
4 0.46
5 0.42
6 0.48
7 0.52
8 0.53
9 0.6
10 0.65
11 0.65
12 0.73
13 0.79
14 0.82
15 0.85
16 0.87
17 0.88
18 0.87
19 0.86
20 0.83
21 0.82
22 0.81
23 0.75
24 0.7
25 0.61
26 0.53
27 0.45
28 0.38
29 0.29
30 0.2
31 0.14
32 0.1
33 0.09
34 0.09
35 0.09
36 0.07
37 0.09
38 0.09
39 0.1
40 0.1
41 0.12
42 0.15
43 0.15
44 0.15
45 0.14
46 0.17
47 0.18
48 0.16
49 0.13
50 0.12
51 0.1
52 0.1
53 0.11
54 0.08
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.1
62 0.1
63 0.09
64 0.09
65 0.15
66 0.17
67 0.22
68 0.26
69 0.33
70 0.35
71 0.41
72 0.49
73 0.53
74 0.61
75 0.6
76 0.64
77 0.65
78 0.7
79 0.73
80 0.75
81 0.74
82 0.66
83 0.64
84 0.56
85 0.5
86 0.48
87 0.41
88 0.39
89 0.37
90 0.36
91 0.36
92 0.35
93 0.34
94 0.31
95 0.31
96 0.25
97 0.22
98 0.23
99 0.26
100 0.3
101 0.34
102 0.34
103 0.37
104 0.43
105 0.44
106 0.49
107 0.47
108 0.52
109 0.57
110 0.65
111 0.69
112 0.68
113 0.73