FuNGI

A0A7J6IDC6

Protein Details

Accession

A0A7J6IDC6

Localization Confidence

Low

Confidence Score

8.2

NoLS Segment(s)

Position	Sequence	Protein Nature
296-315	NKEMRRWYRQWYARHKQNKA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 14, cyto_nucl 13.833, cyto 9.5, cyto_mito 6.832

Family & Domain DBs

Amino Acid Sequences

MEGSSPSRQTVIIDRSTDANVQRCYQLQLKTANSESLKLNLAFAKKNHLIKDVNDDKVRVPQEWFEEGDRKLAAHLGLLTKWRNSLDKTVGNGGAAAAPDVEEVADAAVEDASVLPDVHSSSQAASAGQQSGAPAIPPSQEAPLTTTNSVSILPNDPGRFSSVLAGRRSEAPATASNRDATASIVSGIRSVFGGYHVDGGFPPASSSSPSMWQTGAAAGKTSGLYTVPGYSYSNFAGQHSETPAATADRAKFTGAGASNTFTGGTIPGGFPAEDEVSAQQPEELTPEELAQEMADNKEMRRWYRQWYARHKQNKAAAQQQNHDSAMAQFNNSDETPVTLASSALVDDSLNRPATQKHARRTNTPASSAIPAQVNDRPNEPETRKGPMWKSKPAPGPTLQVRSKEKPAWKV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.33
2	0.35
3	0.37
4	0.39
5	0.35
6	0.36
7	0.33
8	0.33
9	0.35
10	0.34
11	0.37
12	0.38
13	0.38
14	0.37
15	0.41
16	0.43
17	0.45
18	0.46
19	0.47
20	0.42
21	0.4
22	0.36
23	0.32
24	0.32
25	0.27
26	0.27
27	0.25
28	0.28
29	0.3
30	0.29
31	0.35
32	0.38
33	0.43
34	0.43
35	0.45
36	0.44
37	0.42
38	0.52
39	0.5
40	0.5
41	0.47
42	0.46
43	0.41
44	0.46
45	0.45
46	0.36
47	0.31
48	0.28
49	0.31
50	0.33
51	0.34
52	0.3
53	0.33
54	0.32
55	0.33
56	0.29
57	0.24
58	0.21
59	0.21
60	0.17
61	0.13
62	0.15
63	0.13
64	0.15
65	0.19
66	0.21
67	0.2
68	0.22
69	0.23
70	0.24
71	0.25
72	0.31
73	0.33
74	0.36
75	0.38
76	0.4
77	0.38
78	0.34
79	0.31
80	0.24
81	0.19
82	0.14
83	0.11
84	0.06
85	0.06
86	0.05
87	0.05
88	0.05
89	0.03
90	0.03
91	0.03
92	0.03
93	0.03
94	0.03
95	0.03
96	0.03
97	0.03
98	0.03
99	0.03
100	0.04
101	0.04
102	0.04
103	0.05
104	0.06
105	0.07
106	0.08
107	0.08
108	0.08
109	0.1
110	0.1
111	0.09
112	0.1
113	0.11
114	0.11
115	0.1
116	0.1
117	0.09
118	0.09
119	0.09
120	0.08
121	0.07
122	0.07
123	0.07
124	0.08
125	0.09
126	0.1
127	0.1
128	0.1
129	0.14
130	0.16
131	0.18
132	0.18
133	0.17
134	0.16
135	0.16
136	0.16
137	0.13
138	0.11
139	0.11
140	0.12
141	0.15
142	0.15
143	0.15
144	0.15
145	0.17
146	0.15
147	0.14
148	0.17
149	0.18
150	0.23
151	0.24
152	0.24
153	0.23
154	0.24
155	0.25
156	0.2
157	0.16
158	0.14
159	0.18
160	0.21
161	0.22
162	0.21
163	0.2
164	0.2
165	0.2
166	0.17
167	0.13
168	0.09
169	0.07
170	0.07
171	0.07
172	0.07
173	0.07
174	0.07
175	0.06
176	0.06
177	0.06
178	0.05
179	0.05
180	0.07
181	0.06
182	0.09
183	0.09
184	0.09
185	0.08
186	0.1
187	0.09
188	0.08
189	0.08
190	0.06
191	0.06
192	0.07
193	0.09
194	0.08
195	0.12
196	0.13
197	0.14
198	0.14
199	0.13
200	0.12
201	0.13
202	0.13
203	0.09
204	0.08
205	0.07
206	0.08
207	0.08
208	0.08
209	0.06
210	0.05
211	0.05
212	0.06
213	0.07
214	0.06
215	0.07
216	0.08
217	0.09
218	0.1
219	0.1
220	0.12
221	0.11
222	0.12
223	0.13
224	0.13
225	0.14
226	0.14
227	0.14
228	0.12
229	0.12
230	0.12
231	0.1
232	0.11
233	0.12
234	0.12
235	0.13
236	0.13
237	0.13
238	0.12
239	0.12
240	0.16
241	0.14
242	0.15
243	0.13
244	0.14
245	0.14
246	0.14
247	0.14
248	0.09
249	0.08
250	0.06
251	0.06
252	0.06
253	0.06
254	0.06
255	0.07
256	0.07
257	0.07
258	0.08
259	0.08
260	0.07
261	0.08
262	0.09
263	0.09
264	0.1
265	0.1
266	0.08
267	0.07
268	0.08
269	0.09
270	0.1
271	0.09
272	0.1
273	0.1
274	0.1
275	0.1
276	0.1
277	0.08
278	0.07
279	0.07
280	0.08
281	0.11
282	0.12
283	0.12
284	0.16
285	0.2
286	0.22
287	0.29
288	0.31
289	0.36
290	0.45
291	0.53
292	0.57
293	0.65
294	0.72
295	0.74
296	0.81
297	0.78
298	0.75
299	0.76
300	0.74
301	0.69
302	0.69
303	0.66
304	0.61
305	0.63
306	0.59
307	0.55
308	0.48
309	0.42
310	0.32
311	0.28
312	0.29
313	0.24
314	0.2
315	0.16
316	0.16
317	0.19
318	0.18
319	0.17
320	0.11
321	0.12
322	0.13
323	0.12
324	0.13
325	0.09
326	0.09
327	0.09
328	0.09
329	0.07
330	0.06
331	0.06
332	0.05
333	0.07
334	0.09
335	0.14
336	0.15
337	0.15
338	0.16
339	0.18
340	0.27
341	0.35
342	0.41
343	0.47
344	0.56
345	0.6
346	0.64
347	0.71
348	0.73
349	0.68
350	0.63
351	0.56
352	0.49
353	0.49
354	0.44
355	0.39
356	0.31
357	0.26
358	0.27
359	0.3
360	0.31
361	0.29
362	0.31
363	0.32
364	0.32
365	0.4
366	0.4
367	0.43
368	0.42
369	0.49
370	0.5
371	0.54
372	0.6
373	0.61
374	0.65
375	0.66
376	0.69
377	0.7
378	0.75
379	0.72
380	0.69
381	0.63
382	0.65
383	0.63
384	0.66
385	0.62
386	0.61
387	0.64
388	0.64
389	0.68
390	0.68

A0A7J6IDC6

3D AlphaFold-predicted Structure Viewer