Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A7J6IKV4

Protein Details
Accession A0A7J6IKV4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-62PVCRTNGAIRRNRKRKRHREPKPSIHAYABasic
NLS Segment(s)
PositionSequence
43-56RRNRKRKRHREPKP
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSRGSPHRSGVSVHAEKVAPTQLRVFPLGFNEVPVCRTNGAIRRNRKRKRHREPKPSIHAYASLPSRSLLKTVILSKTRHNMISLVNPNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.29
4 0.29
5 0.3
6 0.21
7 0.19
8 0.23
9 0.22
10 0.24
11 0.26
12 0.24
13 0.18
14 0.19
15 0.23
16 0.18
17 0.17
18 0.16
19 0.15
20 0.16
21 0.16
22 0.15
23 0.11
24 0.12
25 0.15
26 0.2
27 0.27
28 0.33
29 0.42
30 0.52
31 0.62
32 0.7
33 0.77
34 0.82
35 0.85
36 0.89
37 0.91
38 0.91
39 0.92
40 0.93
41 0.93
42 0.92
43 0.86
44 0.76
45 0.67
46 0.58
47 0.48
48 0.43
49 0.36
50 0.26
51 0.21
52 0.19
53 0.2
54 0.18
55 0.18
56 0.14
57 0.13
58 0.17
59 0.21
60 0.28
61 0.3
62 0.32
63 0.36
64 0.43
65 0.44
66 0.42
67 0.39
68 0.33
69 0.33
70 0.41