Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2G2C1

Protein Details
Accession L2G2C1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-78ANNAPNPTTRRANKKKPKRRPANEQEFGYGHydrophilic
NLS Segment(s)
PositionSequence
58-69RRANKKKPKRRP
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPPKRSKKTSVASPPAESDNDESEYQASDVSMADATPDDQPEASANKPANNAPNPTTRRANKKKPKRRPANEQEFGYGQLHQEFAAFRRLFQVFLDRTMPQGDGSTAMDVAMKPLASRRPECVVKTSFEPAESRKKFTGYYTGWMKALKQLDNVYHQVREIFVYDDYVNFTFKPPDAAKSFTPNKEDMFKALGSETPVSCFQRADEHYYVELFFRGRDFRHTHASDAKKMLAELGLDSDKFSVMFREKRQRFIAKFTDMAEADRLLELYENEGGTQGEGLLIDYSYAHLRFVLFLSLSVTWHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.6
3 0.52
4 0.44
5 0.36
6 0.3
7 0.29
8 0.26
9 0.24
10 0.21
11 0.21
12 0.19
13 0.15
14 0.11
15 0.08
16 0.08
17 0.08
18 0.08
19 0.06
20 0.07
21 0.07
22 0.08
23 0.1
24 0.1
25 0.1
26 0.1
27 0.11
28 0.13
29 0.16
30 0.15
31 0.19
32 0.19
33 0.22
34 0.24
35 0.27
36 0.33
37 0.34
38 0.37
39 0.36
40 0.44
41 0.45
42 0.48
43 0.54
44 0.52
45 0.59
46 0.65
47 0.73
48 0.74
49 0.82
50 0.87
51 0.9
52 0.94
53 0.94
54 0.94
55 0.94
56 0.94
57 0.94
58 0.9
59 0.8
60 0.72
61 0.62
62 0.55
63 0.45
64 0.34
65 0.24
66 0.17
67 0.15
68 0.11
69 0.11
70 0.1
71 0.1
72 0.19
73 0.18
74 0.17
75 0.22
76 0.23
77 0.22
78 0.22
79 0.29
80 0.2
81 0.23
82 0.25
83 0.2
84 0.21
85 0.22
86 0.21
87 0.13
88 0.13
89 0.11
90 0.1
91 0.1
92 0.09
93 0.08
94 0.08
95 0.08
96 0.07
97 0.08
98 0.07
99 0.06
100 0.05
101 0.09
102 0.14
103 0.17
104 0.19
105 0.21
106 0.27
107 0.31
108 0.32
109 0.35
110 0.32
111 0.3
112 0.31
113 0.31
114 0.25
115 0.23
116 0.23
117 0.21
118 0.3
119 0.29
120 0.31
121 0.28
122 0.29
123 0.29
124 0.29
125 0.34
126 0.24
127 0.29
128 0.29
129 0.29
130 0.28
131 0.28
132 0.27
133 0.23
134 0.24
135 0.19
136 0.17
137 0.18
138 0.19
139 0.22
140 0.25
141 0.22
142 0.18
143 0.18
144 0.16
145 0.14
146 0.13
147 0.1
148 0.09
149 0.07
150 0.09
151 0.09
152 0.09
153 0.11
154 0.11
155 0.1
156 0.09
157 0.1
158 0.09
159 0.09
160 0.15
161 0.13
162 0.17
163 0.19
164 0.22
165 0.22
166 0.29
167 0.35
168 0.33
169 0.35
170 0.32
171 0.31
172 0.32
173 0.31
174 0.25
175 0.22
176 0.19
177 0.16
178 0.15
179 0.15
180 0.13
181 0.14
182 0.13
183 0.13
184 0.16
185 0.17
186 0.17
187 0.16
188 0.14
189 0.21
190 0.23
191 0.28
192 0.26
193 0.26
194 0.26
195 0.27
196 0.27
197 0.19
198 0.18
199 0.11
200 0.1
201 0.1
202 0.12
203 0.12
204 0.18
205 0.22
206 0.25
207 0.34
208 0.35
209 0.37
210 0.43
211 0.48
212 0.46
213 0.45
214 0.42
215 0.33
216 0.32
217 0.29
218 0.21
219 0.17
220 0.12
221 0.13
222 0.12
223 0.12
224 0.12
225 0.12
226 0.11
227 0.11
228 0.1
229 0.12
230 0.17
231 0.23
232 0.31
233 0.42
234 0.44
235 0.51
236 0.59
237 0.64
238 0.61
239 0.63
240 0.62
241 0.56
242 0.56
243 0.51
244 0.49
245 0.4
246 0.38
247 0.31
248 0.24
249 0.2
250 0.18
251 0.16
252 0.1
253 0.11
254 0.09
255 0.1
256 0.12
257 0.11
258 0.11
259 0.11
260 0.11
261 0.1
262 0.1
263 0.07
264 0.06
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.08
272 0.11
273 0.11
274 0.11
275 0.11
276 0.12
277 0.13
278 0.14
279 0.16
280 0.12
281 0.13
282 0.16
283 0.16