Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2FHQ5

Protein Details
Accession L2FHQ5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
226-253VSSCVWCCVRKCKKNRREKRAIKAAAATHydrophilic
NLS Segment(s)
PositionSequence
238-248KKNRREKRAIK
Subcellular Location(s) plas 10, extr 8, mito 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLTATTATTSNAITTAASISVLTITTPWVEPSDCASQWTTRIVSYEMYGGTTVTQEYTISNPAATCYPSGWDGFAPEHRLRFRPGVCPDGWVYNDMAEPITRVVSTAHCCQSGFDRLGTHTLRSLSTLAPLCAKSEWTTVGTRSGPRTLVHDAWIVTWAKSDTATLTPKLPTLTSGMRVHTWTPGEKIPKGRDDANKVDNGVQYMSQGVLWFLMVGMPIIGALMVSSCVWCCVRKCKKNRREKRAIKAAAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.07
7 0.07
8 0.07
9 0.07
10 0.06
11 0.06
12 0.06
13 0.08
14 0.08
15 0.09
16 0.11
17 0.11
18 0.12
19 0.17
20 0.22
21 0.21
22 0.22
23 0.23
24 0.23
25 0.24
26 0.28
27 0.24
28 0.18
29 0.2
30 0.19
31 0.18
32 0.17
33 0.17
34 0.14
35 0.13
36 0.13
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.07
43 0.06
44 0.07
45 0.09
46 0.11
47 0.11
48 0.11
49 0.1
50 0.11
51 0.12
52 0.12
53 0.11
54 0.09
55 0.1
56 0.11
57 0.12
58 0.11
59 0.1
60 0.11
61 0.12
62 0.14
63 0.19
64 0.19
65 0.23
66 0.25
67 0.27
68 0.29
69 0.33
70 0.32
71 0.35
72 0.37
73 0.37
74 0.35
75 0.35
76 0.33
77 0.3
78 0.29
79 0.21
80 0.18
81 0.14
82 0.14
83 0.12
84 0.11
85 0.07
86 0.07
87 0.06
88 0.06
89 0.05
90 0.06
91 0.06
92 0.09
93 0.12
94 0.16
95 0.18
96 0.18
97 0.18
98 0.18
99 0.2
100 0.22
101 0.2
102 0.16
103 0.15
104 0.15
105 0.2
106 0.2
107 0.17
108 0.15
109 0.14
110 0.14
111 0.14
112 0.15
113 0.1
114 0.13
115 0.13
116 0.12
117 0.13
118 0.13
119 0.12
120 0.11
121 0.12
122 0.1
123 0.1
124 0.11
125 0.12
126 0.12
127 0.12
128 0.15
129 0.16
130 0.17
131 0.18
132 0.18
133 0.17
134 0.17
135 0.2
136 0.21
137 0.2
138 0.2
139 0.2
140 0.18
141 0.17
142 0.2
143 0.16
144 0.12
145 0.13
146 0.11
147 0.1
148 0.1
149 0.1
150 0.08
151 0.12
152 0.14
153 0.14
154 0.16
155 0.16
156 0.17
157 0.18
158 0.16
159 0.13
160 0.15
161 0.16
162 0.2
163 0.21
164 0.22
165 0.22
166 0.24
167 0.24
168 0.23
169 0.23
170 0.19
171 0.2
172 0.24
173 0.27
174 0.29
175 0.36
176 0.37
177 0.4
178 0.42
179 0.46
180 0.48
181 0.5
182 0.53
183 0.51
184 0.48
185 0.44
186 0.44
187 0.39
188 0.33
189 0.27
190 0.2
191 0.15
192 0.14
193 0.13
194 0.1
195 0.09
196 0.07
197 0.06
198 0.06
199 0.05
200 0.05
201 0.05
202 0.05
203 0.04
204 0.04
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.02
211 0.03
212 0.04
213 0.04
214 0.05
215 0.05
216 0.08
217 0.1
218 0.13
219 0.17
220 0.28
221 0.39
222 0.48
223 0.6
224 0.68
225 0.77
226 0.85
227 0.93
228 0.93
229 0.93
230 0.94
231 0.94
232 0.93
233 0.89