Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2FM02

Protein Details
Accession L2FM02    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
583-605VFEPGEKKPLKPQKRQNATNGAAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 10.5, pero 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR011068  NuclTrfase_I-like_C  
IPR007012  PolA_pol_cen_dom  
IPR007010  PolA_pol_RNA-bd_dom  
IPR014492  PolyA_polymerase  
IPR002934  Polymerase_NTP_transf_dom  
Gene Ontology GO:0005829  C:cytosol  
GO:0033620  C:Mei2 nuclear dot complex  
GO:0005847  C:mRNA cleavage and polyadenylation specificity factor complex  
GO:1990251  C:nuclear exosome focus  
GO:0005524  F:ATP binding  
GO:0000287  F:magnesium ion binding  
GO:1990817  F:poly(A) RNA polymerase activity  
GO:0003723  F:RNA binding  
GO:0006378  P:mRNA polyadenylation  
GO:0033621  P:nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts  
GO:0098789  P:pre-mRNA cleavage required for polyadenylation  
GO:0071050  P:sno(s)RNA polyadenylation  
Pfam View protein in Pfam  
PF01909  NTP_transf_2  
PF04928  PAP_central  
PF04926  PAP_RNA-bind  
CDD cd05402  NT_PAP_TUTase  
Amino Acid Sequences MASEERAYGVTPPISTALPTELENQAKEALIEELKKQNTFETRQSNPFLGESRYQVINHLQQICDEFVKRVARKREEGNEALIRDARGQIFTYGSFRLGVYGPGSDIDTLVVAPKYVTRSDYFEIFPGLLKEMAPSDAITDMAVVEDAFVPIIKFEFFGISIDLIFSRIAMLKQLPKEFNVQDSGLLRGLDEAELRSLNGTRVTDEILSLVPEEATFKLALRAIKLWAQRRAIYANIMGFPGGVAWAMLVARVCQLYPKAASSVIVNKFFHIMRRWPWPQPVLLKNVEGGPLQVRVWNPKVYKGDQFHLMPVITPAYPSMCATYNITRSAMTVIQQELTRGCEITDNIMVGKNPWSDLFVKHTFFTQGYKYYISVITASTDKEAHKIWSGYVESKVRVLVQGLEQHQSIALAHAFNKGYERRHRCTSDEEVQQIQAGSLNFLVKDSQATDDAGALKEEKLETKAELNGIPGLKTETDNIPGLKAEALDTNVGSKKEVIEEDKFKLEDEHQVKLEDCKPRSPLAEVFTTTHYIGLTLSEGAKSLDLSYQVDNFKSLCTSWDKYEPTLNSLTVQHVRSFNLPDDVFEPGEKKPLKPQKRQNATNGAAQVKKRGASEETPQPPAKRQAASVTAAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.16
5 0.15
6 0.17
7 0.19
8 0.23
9 0.26
10 0.26
11 0.26
12 0.24
13 0.23
14 0.21
15 0.19
16 0.16
17 0.17
18 0.19
19 0.22
20 0.28
21 0.32
22 0.33
23 0.32
24 0.35
25 0.39
26 0.43
27 0.47
28 0.47
29 0.5
30 0.56
31 0.59
32 0.54
33 0.48
34 0.45
35 0.4
36 0.36
37 0.33
38 0.3
39 0.3
40 0.31
41 0.29
42 0.29
43 0.33
44 0.35
45 0.38
46 0.38
47 0.34
48 0.33
49 0.36
50 0.35
51 0.32
52 0.27
53 0.21
54 0.24
55 0.33
56 0.36
57 0.42
58 0.49
59 0.53
60 0.58
61 0.65
62 0.68
63 0.67
64 0.65
65 0.63
66 0.59
67 0.52
68 0.49
69 0.42
70 0.34
71 0.27
72 0.28
73 0.22
74 0.18
75 0.18
76 0.18
77 0.17
78 0.18
79 0.19
80 0.16
81 0.16
82 0.15
83 0.14
84 0.15
85 0.13
86 0.14
87 0.12
88 0.12
89 0.11
90 0.11
91 0.12
92 0.1
93 0.1
94 0.08
95 0.07
96 0.07
97 0.09
98 0.08
99 0.07
100 0.07
101 0.1
102 0.13
103 0.14
104 0.16
105 0.16
106 0.22
107 0.24
108 0.27
109 0.26
110 0.24
111 0.24
112 0.21
113 0.2
114 0.16
115 0.15
116 0.12
117 0.11
118 0.11
119 0.11
120 0.11
121 0.11
122 0.09
123 0.09
124 0.09
125 0.09
126 0.08
127 0.07
128 0.06
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.05
135 0.04
136 0.05
137 0.05
138 0.05
139 0.06
140 0.05
141 0.05
142 0.06
143 0.07
144 0.07
145 0.08
146 0.09
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.07
153 0.06
154 0.06
155 0.07
156 0.07
157 0.09
158 0.12
159 0.17
160 0.22
161 0.28
162 0.28
163 0.28
164 0.34
165 0.33
166 0.33
167 0.3
168 0.26
169 0.23
170 0.23
171 0.23
172 0.18
173 0.17
174 0.14
175 0.11
176 0.12
177 0.09
178 0.09
179 0.07
180 0.07
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.11
187 0.11
188 0.11
189 0.11
190 0.13
191 0.12
192 0.11
193 0.11
194 0.09
195 0.08
196 0.08
197 0.07
198 0.05
199 0.05
200 0.07
201 0.06
202 0.07
203 0.07
204 0.07
205 0.09
206 0.12
207 0.12
208 0.13
209 0.14
210 0.14
211 0.19
212 0.24
213 0.28
214 0.32
215 0.34
216 0.34
217 0.35
218 0.36
219 0.32
220 0.28
221 0.24
222 0.19
223 0.17
224 0.15
225 0.13
226 0.1
227 0.09
228 0.07
229 0.05
230 0.03
231 0.02
232 0.02
233 0.03
234 0.03
235 0.03
236 0.03
237 0.04
238 0.05
239 0.05
240 0.05
241 0.06
242 0.07
243 0.09
244 0.1
245 0.11
246 0.11
247 0.11
248 0.11
249 0.12
250 0.19
251 0.2
252 0.24
253 0.23
254 0.22
255 0.24
256 0.24
257 0.26
258 0.22
259 0.22
260 0.21
261 0.3
262 0.33
263 0.34
264 0.38
265 0.37
266 0.37
267 0.4
268 0.4
269 0.37
270 0.34
271 0.31
272 0.28
273 0.26
274 0.24
275 0.17
276 0.14
277 0.1
278 0.1
279 0.09
280 0.11
281 0.11
282 0.14
283 0.17
284 0.21
285 0.21
286 0.26
287 0.3
288 0.3
289 0.36
290 0.34
291 0.34
292 0.33
293 0.33
294 0.27
295 0.25
296 0.22
297 0.15
298 0.13
299 0.12
300 0.08
301 0.07
302 0.07
303 0.06
304 0.07
305 0.07
306 0.08
307 0.08
308 0.09
309 0.11
310 0.14
311 0.16
312 0.16
313 0.17
314 0.15
315 0.14
316 0.15
317 0.13
318 0.11
319 0.11
320 0.1
321 0.11
322 0.11
323 0.11
324 0.1
325 0.11
326 0.1
327 0.09
328 0.08
329 0.09
330 0.09
331 0.11
332 0.11
333 0.09
334 0.09
335 0.1
336 0.1
337 0.09
338 0.11
339 0.09
340 0.09
341 0.09
342 0.11
343 0.12
344 0.13
345 0.19
346 0.19
347 0.2
348 0.2
349 0.21
350 0.2
351 0.19
352 0.2
353 0.16
354 0.16
355 0.16
356 0.17
357 0.17
358 0.17
359 0.17
360 0.15
361 0.13
362 0.1
363 0.1
364 0.1
365 0.1
366 0.09
367 0.11
368 0.11
369 0.12
370 0.13
371 0.13
372 0.15
373 0.15
374 0.14
375 0.17
376 0.19
377 0.19
378 0.22
379 0.23
380 0.2
381 0.2
382 0.2
383 0.16
384 0.15
385 0.14
386 0.11
387 0.11
388 0.16
389 0.17
390 0.19
391 0.18
392 0.17
393 0.17
394 0.15
395 0.13
396 0.08
397 0.08
398 0.07
399 0.07
400 0.11
401 0.11
402 0.11
403 0.16
404 0.18
405 0.23
406 0.32
407 0.39
408 0.41
409 0.49
410 0.52
411 0.5
412 0.53
413 0.55
414 0.53
415 0.5
416 0.48
417 0.41
418 0.38
419 0.36
420 0.3
421 0.22
422 0.17
423 0.12
424 0.1
425 0.09
426 0.1
427 0.09
428 0.09
429 0.1
430 0.07
431 0.08
432 0.09
433 0.09
434 0.1
435 0.1
436 0.1
437 0.12
438 0.13
439 0.12
440 0.12
441 0.11
442 0.1
443 0.11
444 0.11
445 0.11
446 0.11
447 0.12
448 0.13
449 0.15
450 0.16
451 0.17
452 0.17
453 0.16
454 0.18
455 0.17
456 0.16
457 0.14
458 0.14
459 0.13
460 0.13
461 0.15
462 0.13
463 0.16
464 0.18
465 0.18
466 0.17
467 0.16
468 0.16
469 0.14
470 0.12
471 0.1
472 0.1
473 0.11
474 0.11
475 0.11
476 0.14
477 0.16
478 0.17
479 0.16
480 0.15
481 0.15
482 0.17
483 0.2
484 0.21
485 0.25
486 0.29
487 0.31
488 0.35
489 0.34
490 0.31
491 0.31
492 0.27
493 0.31
494 0.29
495 0.31
496 0.28
497 0.3
498 0.3
499 0.33
500 0.37
501 0.36
502 0.35
503 0.36
504 0.38
505 0.4
506 0.42
507 0.4
508 0.39
509 0.34
510 0.36
511 0.33
512 0.32
513 0.31
514 0.32
515 0.27
516 0.23
517 0.19
518 0.15
519 0.13
520 0.11
521 0.1
522 0.09
523 0.09
524 0.08
525 0.09
526 0.09
527 0.09
528 0.09
529 0.09
530 0.1
531 0.11
532 0.13
533 0.15
534 0.19
535 0.21
536 0.21
537 0.21
538 0.19
539 0.19
540 0.18
541 0.16
542 0.15
543 0.2
544 0.23
545 0.27
546 0.34
547 0.36
548 0.37
549 0.45
550 0.42
551 0.4
552 0.4
553 0.36
554 0.3
555 0.29
556 0.33
557 0.3
558 0.31
559 0.3
560 0.3
561 0.31
562 0.32
563 0.35
564 0.31
565 0.33
566 0.31
567 0.28
568 0.28
569 0.29
570 0.26
571 0.23
572 0.23
573 0.17
574 0.26
575 0.26
576 0.26
577 0.34
578 0.44
579 0.53
580 0.61
581 0.71
582 0.74
583 0.83
584 0.88
585 0.87
586 0.86
587 0.79
588 0.75
589 0.71
590 0.65
591 0.6
592 0.54
593 0.52
594 0.45
595 0.45
596 0.39
597 0.37
598 0.37
599 0.37
600 0.43
601 0.46
602 0.48
603 0.52
604 0.55
605 0.54
606 0.56
607 0.6
608 0.59
609 0.51
610 0.49
611 0.5
612 0.5