Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A7J6IRN7

Protein Details
Accession A0A7J6IRN7   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-60EVPCAWCKDRKHLCRRCKRRQQISSAGARKSHydrophilic
146-166GHQRRRMQPRRPRMSERRRSSBasic
223-242KGVGRRRKWDEQKGELRWRSBasic
NLS Segment(s)
PositionSequence
149-164RRRMQPRRPRMSERRR
199-235RKRAPERRAQKRVWQNERVQRAPVKGVGRRRKWDEQK
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, plas 4, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDSMYWDVLPADDSESSSDEEGNECAPSLEVPCAWCKDRKHLCRRCKRRQQISSAGARKSSLEKACFHPRATSSDAPAPVPEVLLPSPDDETPTPRNGAAAPVYAAMYTASPSWMSTYTSSTCATTYTAAHERSQRERAPLLEVAGHQRRRMQPRRPRMSERRRSSGWQTSEVEGWDEREIEGDGSYWDVEGARWEEQRKRAPERRAQKRVWQNERVQRAPVKGVGRRRKWDEQKGELRWRSRPLVEPLTPRYLHDVVMCYIPSVVLALLCLYVSLVALTSILHVFVLPGVLMKATCPPSSPVLYFLID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.16
4 0.15
5 0.15
6 0.13
7 0.14
8 0.14
9 0.13
10 0.11
11 0.1
12 0.09
13 0.09
14 0.09
15 0.1
16 0.11
17 0.11
18 0.12
19 0.17
20 0.21
21 0.23
22 0.29
23 0.31
24 0.4
25 0.5
26 0.58
27 0.66
28 0.71
29 0.8
30 0.85
31 0.92
32 0.93
33 0.93
34 0.94
35 0.94
36 0.93
37 0.91
38 0.9
39 0.87
40 0.87
41 0.82
42 0.72
43 0.62
44 0.54
45 0.46
46 0.4
47 0.39
48 0.35
49 0.31
50 0.33
51 0.39
52 0.49
53 0.5
54 0.47
55 0.45
56 0.41
57 0.43
58 0.47
59 0.42
60 0.36
61 0.38
62 0.37
63 0.33
64 0.31
65 0.27
66 0.2
67 0.18
68 0.14
69 0.11
70 0.09
71 0.1
72 0.11
73 0.1
74 0.11
75 0.11
76 0.14
77 0.12
78 0.18
79 0.2
80 0.21
81 0.21
82 0.19
83 0.2
84 0.18
85 0.2
86 0.15
87 0.13
88 0.11
89 0.11
90 0.11
91 0.1
92 0.1
93 0.07
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.06
100 0.07
101 0.08
102 0.09
103 0.1
104 0.13
105 0.14
106 0.16
107 0.17
108 0.15
109 0.15
110 0.14
111 0.14
112 0.11
113 0.1
114 0.13
115 0.17
116 0.18
117 0.2
118 0.25
119 0.27
120 0.31
121 0.37
122 0.34
123 0.32
124 0.32
125 0.31
126 0.3
127 0.27
128 0.22
129 0.18
130 0.16
131 0.2
132 0.25
133 0.25
134 0.22
135 0.26
136 0.32
137 0.4
138 0.49
139 0.52
140 0.55
141 0.65
142 0.74
143 0.75
144 0.79
145 0.8
146 0.82
147 0.83
148 0.8
149 0.75
150 0.67
151 0.65
152 0.62
153 0.6
154 0.51
155 0.46
156 0.41
157 0.36
158 0.35
159 0.31
160 0.26
161 0.17
162 0.16
163 0.12
164 0.1
165 0.08
166 0.08
167 0.08
168 0.07
169 0.07
170 0.06
171 0.05
172 0.06
173 0.06
174 0.05
175 0.04
176 0.04
177 0.04
178 0.06
179 0.08
180 0.1
181 0.12
182 0.16
183 0.21
184 0.27
185 0.35
186 0.39
187 0.47
188 0.52
189 0.59
190 0.64
191 0.7
192 0.75
193 0.76
194 0.74
195 0.74
196 0.76
197 0.78
198 0.78
199 0.75
200 0.73
201 0.72
202 0.76
203 0.69
204 0.63
205 0.56
206 0.5
207 0.45
208 0.41
209 0.39
210 0.37
211 0.45
212 0.51
213 0.55
214 0.6
215 0.65
216 0.7
217 0.74
218 0.79
219 0.78
220 0.77
221 0.79
222 0.79
223 0.82
224 0.77
225 0.72
226 0.67
227 0.64
228 0.59
229 0.53
230 0.51
231 0.48
232 0.51
233 0.52
234 0.53
235 0.52
236 0.55
237 0.51
238 0.46
239 0.45
240 0.37
241 0.34
242 0.29
243 0.27
244 0.21
245 0.23
246 0.22
247 0.16
248 0.15
249 0.13
250 0.11
251 0.08
252 0.07
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.05
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.06
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.07
275 0.05
276 0.05
277 0.06
278 0.07
279 0.07
280 0.07
281 0.14
282 0.17
283 0.18
284 0.19
285 0.22
286 0.27
287 0.32
288 0.32
289 0.29