Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GR52

Protein Details
Accession L2GR52    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MVNVPKTRKNYCQKCNKHEEMKVSIYKQGKRNPNRQGERRYRIKQHydrophilic
NLS Segment(s)
PositionSequence
29-66GKRNPNRQGERRYRIKQRGYGGQKRPILRRKAKVTKKP
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKNYCQKCNKHEEMKVSIYKQGKRNPNRQGERRYRIKQRGYGGQKRPILRRKAKVTKKPVLKLECKTCHSKVMKAIHRAKHVMISNEKKVKGQALTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.86
4 0.84
5 0.79
6 0.75
7 0.7
8 0.67
9 0.63
10 0.54
11 0.52
12 0.49
13 0.5
14 0.5
15 0.52
16 0.56
17 0.59
18 0.66
19 0.7
20 0.74
21 0.77
22 0.78
23 0.8
24 0.81
25 0.81
26 0.81
27 0.79
28 0.78
29 0.77
30 0.75
31 0.71
32 0.65
33 0.66
34 0.66
35 0.68
36 0.64
37 0.63
38 0.61
39 0.59
40 0.62
41 0.6
42 0.61
43 0.59
44 0.61
45 0.64
46 0.7
47 0.76
48 0.78
49 0.79
50 0.78
51 0.79
52 0.77
53 0.75
54 0.73
55 0.7
56 0.67
57 0.68
58 0.66
59 0.61
60 0.61
61 0.55
62 0.56
63 0.53
64 0.5
65 0.48
66 0.51
67 0.55
68 0.58
69 0.65
70 0.63
71 0.66
72 0.64
73 0.57
74 0.55
75 0.52
76 0.49
77 0.5
78 0.51
79 0.54
80 0.59
81 0.59
82 0.53
83 0.52
84 0.51