Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GLK7

Protein Details
Accession L2GLK7    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-103LLSKIRKIYKKIKRIHREYNKDKPYIHydrophilic
NLS Segment(s)
PositionSequence
83-91RKIYKKIKR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MKERGQEWVDETVHCKILTDSQIETLERFMIRHNLKLSKKDVSKAAKNLKIPIKSALVYFQSVQKELVNSGFGTNKELLSKIRKIYKKIKRIHREYNKDKPYINTMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.17
4 0.22
5 0.24
6 0.23
7 0.21
8 0.22
9 0.24
10 0.24
11 0.24
12 0.18
13 0.17
14 0.15
15 0.15
16 0.13
17 0.19
18 0.2
19 0.24
20 0.28
21 0.34
22 0.37
23 0.42
24 0.44
25 0.43
26 0.44
27 0.42
28 0.46
29 0.44
30 0.47
31 0.5
32 0.55
33 0.52
34 0.51
35 0.54
36 0.52
37 0.47
38 0.43
39 0.37
40 0.31
41 0.26
42 0.25
43 0.21
44 0.17
45 0.16
46 0.15
47 0.17
48 0.16
49 0.16
50 0.17
51 0.15
52 0.14
53 0.13
54 0.14
55 0.11
56 0.1
57 0.11
58 0.12
59 0.12
60 0.14
61 0.14
62 0.14
63 0.14
64 0.15
65 0.17
66 0.21
67 0.25
68 0.28
69 0.37
70 0.41
71 0.47
72 0.57
73 0.63
74 0.67
75 0.72
76 0.77
77 0.79
78 0.83
79 0.87
80 0.88
81 0.89
82 0.88
83 0.9
84 0.87
85 0.8
86 0.74
87 0.67