Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GKU5

Protein Details
Accession L2GKU5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-67ATKIEKGSYNRARKARKKLEEAEQKQHydrophilic
NLS Segment(s)
PositionSequence
40-59KKATKIEKGSYNRARKARKK
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031547  DUF5089  
Pfam View protein in Pfam  
PF17002  DUF5089  
Amino Acid Sequences VNGLRNSLTSMTMKDPYDLQQAQKQKKTSLEQELSEEAAKKATKIEKGSYNRARKARKKLEEAEQKQKMTTEEVRKQNESLEHGRQGAFKVHEEAEKAKDTAITLEKERNAFDILAPAKAKYGKWAAKDAQAAAEIEQMKNKSSEQLENEAMSENKELGNLNAKTEAEAKTNKELQKIYKSVKRINKETEVQSRESKKQKSKLGDIMKTSEYAKKSVKETDEKLRKNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.33
5 0.33
6 0.32
7 0.35
8 0.44
9 0.52
10 0.57
11 0.56
12 0.52
13 0.58
14 0.61
15 0.61
16 0.62
17 0.58
18 0.53
19 0.54
20 0.51
21 0.45
22 0.39
23 0.33
24 0.22
25 0.22
26 0.2
27 0.17
28 0.21
29 0.25
30 0.29
31 0.31
32 0.37
33 0.42
34 0.48
35 0.58
36 0.62
37 0.65
38 0.67
39 0.71
40 0.76
41 0.75
42 0.8
43 0.8
44 0.79
45 0.79
46 0.77
47 0.8
48 0.81
49 0.79
50 0.78
51 0.74
52 0.66
53 0.58
54 0.53
55 0.44
56 0.38
57 0.39
58 0.38
59 0.4
60 0.47
61 0.51
62 0.51
63 0.5
64 0.48
65 0.43
66 0.39
67 0.36
68 0.32
69 0.29
70 0.29
71 0.29
72 0.27
73 0.25
74 0.24
75 0.2
76 0.17
77 0.18
78 0.18
79 0.18
80 0.19
81 0.2
82 0.19
83 0.19
84 0.18
85 0.15
86 0.15
87 0.14
88 0.15
89 0.16
90 0.14
91 0.14
92 0.17
93 0.18
94 0.18
95 0.19
96 0.17
97 0.15
98 0.13
99 0.12
100 0.14
101 0.13
102 0.14
103 0.14
104 0.13
105 0.13
106 0.15
107 0.14
108 0.13
109 0.2
110 0.21
111 0.23
112 0.29
113 0.29
114 0.32
115 0.33
116 0.3
117 0.24
118 0.21
119 0.19
120 0.14
121 0.17
122 0.13
123 0.12
124 0.14
125 0.13
126 0.13
127 0.14
128 0.14
129 0.14
130 0.16
131 0.2
132 0.21
133 0.25
134 0.26
135 0.25
136 0.25
137 0.23
138 0.2
139 0.17
140 0.14
141 0.1
142 0.08
143 0.09
144 0.09
145 0.08
146 0.17
147 0.16
148 0.17
149 0.19
150 0.19
151 0.19
152 0.22
153 0.23
154 0.18
155 0.21
156 0.23
157 0.27
158 0.34
159 0.34
160 0.36
161 0.37
162 0.39
163 0.45
164 0.48
165 0.49
166 0.48
167 0.52
168 0.56
169 0.62
170 0.64
171 0.62
172 0.64
173 0.64
174 0.65
175 0.66
176 0.68
177 0.63
178 0.59
179 0.6
180 0.59
181 0.6
182 0.63
183 0.64
184 0.64
185 0.68
186 0.73
187 0.73
188 0.75
189 0.77
190 0.78
191 0.75
192 0.7
193 0.66
194 0.58
195 0.52
196 0.46
197 0.42
198 0.34
199 0.33
200 0.34
201 0.34
202 0.37
203 0.43
204 0.48
205 0.5
206 0.54
207 0.6
208 0.65