Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GPK9

Protein Details
Accession L2GPK9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45LEAPKKIKKKHSPYFPNILCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR041367  Znf-CCCH_4  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF18044  zf-CCCH_4  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MLRKLNVPTHHSKVYISKYLNKDEVLEAPKKIKKKHSPYFPNILCKFYAKNGCSKGDECIFSHDISRFQTGIEETEYALKEEDENEDMKKLHEDKSTFVSPFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.44
4 0.46
5 0.47
6 0.52
7 0.52
8 0.45
9 0.4
10 0.34
11 0.37
12 0.33
13 0.3
14 0.26
15 0.3
16 0.33
17 0.37
18 0.41
19 0.45
20 0.51
21 0.59
22 0.67
23 0.71
24 0.76
25 0.77
26 0.82
27 0.75
28 0.75
29 0.65
30 0.58
31 0.48
32 0.4
33 0.35
34 0.3
35 0.33
36 0.24
37 0.28
38 0.3
39 0.31
40 0.32
41 0.31
42 0.29
43 0.25
44 0.26
45 0.21
46 0.23
47 0.22
48 0.2
49 0.21
50 0.19
51 0.18
52 0.19
53 0.2
54 0.15
55 0.13
56 0.15
57 0.14
58 0.14
59 0.14
60 0.12
61 0.1
62 0.14
63 0.15
64 0.14
65 0.13
66 0.12
67 0.11
68 0.11
69 0.14
70 0.12
71 0.13
72 0.13
73 0.15
74 0.16
75 0.16
76 0.22
77 0.21
78 0.25
79 0.31
80 0.31
81 0.32
82 0.39
83 0.43