Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GLY4

Protein Details
Accession L2GLY4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGARKSTRKKVRKPAVQKIETRFHydrophilic
NLS Segment(s)
PositionSequence
5-13KSTRKKVRK
Subcellular Location(s) mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGARKSTRKKVRKPAVQKIETRFDCPVCNHENVVQCKLVSKTKRGMVFCSICESHFSCEVTTLDKPIDVYHTWIDQISSTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.88
4 0.84
5 0.79
6 0.79
7 0.69
8 0.63
9 0.55
10 0.45
11 0.41
12 0.36
13 0.35
14 0.28
15 0.28
16 0.25
17 0.27
18 0.32
19 0.32
20 0.33
21 0.29
22 0.25
23 0.25
24 0.26
25 0.28
26 0.24
27 0.24
28 0.27
29 0.3
30 0.36
31 0.35
32 0.35
33 0.36
34 0.35
35 0.32
36 0.32
37 0.28
38 0.23
39 0.25
40 0.24
41 0.2
42 0.21
43 0.21
44 0.16
45 0.18
46 0.18
47 0.19
48 0.18
49 0.17
50 0.15
51 0.14
52 0.15
53 0.13
54 0.17
55 0.14
56 0.17
57 0.18
58 0.19
59 0.19
60 0.19
61 0.19
62 0.17