Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GMY6

Protein Details
Accession L2GMY6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-26SLNDLHKKRKTRFPLSRIKKIMQHydrophilic
NLS Segment(s)
PositionSequence
12-12R
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MDHSLNDLHKKRKTRFPLSRIKKIMQQNEDVGKAAITVPVVLSKALEMFFEQIISKMAESAKRRESAKIQAQDFRSVVKSNEELYSFLVPLCSTEKEDSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.79
4 0.84
5 0.83
6 0.87
7 0.82
8 0.75
9 0.72
10 0.7
11 0.7
12 0.63
13 0.58
14 0.53
15 0.51
16 0.49
17 0.41
18 0.33
19 0.23
20 0.19
21 0.15
22 0.11
23 0.07
24 0.06
25 0.05
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.13
46 0.16
47 0.21
48 0.24
49 0.27
50 0.29
51 0.31
52 0.35
53 0.38
54 0.45
55 0.47
56 0.45
57 0.47
58 0.48
59 0.5
60 0.45
61 0.38
62 0.32
63 0.27
64 0.25
65 0.24
66 0.23
67 0.21
68 0.24
69 0.22
70 0.21
71 0.22
72 0.23
73 0.18
74 0.17
75 0.15
76 0.12
77 0.13
78 0.16
79 0.15
80 0.17