Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GIL1

Protein Details
Accession L2GIL1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
95-115FIEYCKQYSKVKKLKPIVSRIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, cyto 10, nucl 9, mito 7
Family & Domain DBs
Amino Acid Sequences MKKVESRNKEIIEVIKEWSRIHCLKDFAALEHQMSQHMGFCAEFSPTILKILFICYNFDQDETLANKLLTDLIPDSTLDELVVIFNKITAFSDAFIEYCKQYSKVKKLKPIVSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.31
4 0.29
5 0.28
6 0.3
7 0.28
8 0.3
9 0.31
10 0.3
11 0.29
12 0.35
13 0.33
14 0.28
15 0.31
16 0.28
17 0.24
18 0.24
19 0.23
20 0.17
21 0.17
22 0.15
23 0.12
24 0.11
25 0.11
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.06
32 0.08
33 0.08
34 0.09
35 0.09
36 0.09
37 0.08
38 0.11
39 0.13
40 0.11
41 0.14
42 0.13
43 0.15
44 0.15
45 0.15
46 0.12
47 0.1
48 0.13
49 0.12
50 0.13
51 0.11
52 0.11
53 0.1
54 0.1
55 0.11
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.08
64 0.08
65 0.06
66 0.06
67 0.05
68 0.05
69 0.06
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.08
76 0.1
77 0.09
78 0.1
79 0.12
80 0.12
81 0.12
82 0.13
83 0.14
84 0.12
85 0.14
86 0.16
87 0.16
88 0.24
89 0.34
90 0.43
91 0.51
92 0.58
93 0.67
94 0.74
95 0.8