Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GNE8

Protein Details
Accession L2GNE8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-132RITGEKLSKIPRRQKKDARIKKYKRFGTLKRNMKRASRRRQDBasic
NLS Segment(s)
PositionSequence
96-131KLSKIPRRQKKDARIKKYKRFGTLKRNMKRASRRRQ
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MAFQLKVLKSTSNQLLNRKELQLEITHTNQSSPDKKSVTEELSSNYSIPAEQIYVYGMRTKPGLHKTIASANMYSAFEDLKKIERSFVVARITGEKLSKIPRRQKKDARIKKYKRFGTLKRNMKRASRRRQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.54
4 0.56
5 0.51
6 0.45
7 0.37
8 0.35
9 0.3
10 0.28
11 0.27
12 0.26
13 0.27
14 0.26
15 0.25
16 0.25
17 0.28
18 0.29
19 0.28
20 0.32
21 0.3
22 0.31
23 0.35
24 0.37
25 0.35
26 0.31
27 0.28
28 0.25
29 0.27
30 0.27
31 0.22
32 0.17
33 0.14
34 0.12
35 0.11
36 0.08
37 0.06
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.1
44 0.1
45 0.1
46 0.1
47 0.11
48 0.16
49 0.2
50 0.22
51 0.2
52 0.2
53 0.22
54 0.26
55 0.28
56 0.23
57 0.18
58 0.16
59 0.18
60 0.17
61 0.15
62 0.1
63 0.08
64 0.07
65 0.08
66 0.09
67 0.12
68 0.15
69 0.15
70 0.16
71 0.16
72 0.21
73 0.22
74 0.25
75 0.23
76 0.21
77 0.21
78 0.23
79 0.24
80 0.21
81 0.2
82 0.17
83 0.17
84 0.25
85 0.32
86 0.38
87 0.47
88 0.56
89 0.64
90 0.73
91 0.81
92 0.83
93 0.87
94 0.88
95 0.89
96 0.9
97 0.91
98 0.91
99 0.92
100 0.88
101 0.86
102 0.85
103 0.84
104 0.84
105 0.84
106 0.84
107 0.82
108 0.85
109 0.8
110 0.81
111 0.82
112 0.82