Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GIX6

Protein Details
Accession L2GIX6   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-22KGTPSFGKRRTRNHLLCPRCHydrophilic
39-81FPEAKRRTRRSLKAQRRTGQGTGRMRYLKRVHRKSKSGFKEHPBasic
NLS Segment(s)
PositionSequence
43-82KRRTRRSLKAQRRTGQGTGRMRYLKRVHRKSKSGFKEHPI
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MSKGTPSFGKRRTRNHLLCPRCGDMSYHKQIRRCSSCAFPEAKRRTRRSLKAQRRTGQGTGRMRYLKRVHRKSKSGFKEHPILAKLRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.82
4 0.77
5 0.76
6 0.72
7 0.66
8 0.56
9 0.5
10 0.42
11 0.39
12 0.43
13 0.45
14 0.47
15 0.46
16 0.5
17 0.54
18 0.6
19 0.58
20 0.53
21 0.47
22 0.44
23 0.45
24 0.45
25 0.43
26 0.37
27 0.41
28 0.46
29 0.51
30 0.54
31 0.56
32 0.6
33 0.66
34 0.7
35 0.71
36 0.74
37 0.77
38 0.79
39 0.84
40 0.81
41 0.78
42 0.75
43 0.68
44 0.63
45 0.6
46 0.57
47 0.5
48 0.49
49 0.48
50 0.43
51 0.48
52 0.5
53 0.51
54 0.55
55 0.64
56 0.69
57 0.73
58 0.82
59 0.83
60 0.85
61 0.85
62 0.84
63 0.8
64 0.76
65 0.75
66 0.7
67 0.68
68 0.6