Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GKS9

Protein Details
Accession L2GKS9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
64-85EISHFCKKLREKCRHARVHRIYBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Pfam View protein in Pfam  
PF05833  NFACT_N  
Amino Acid Sequences MKQRFTLLDLRATVNELNERLTNTFIQNFYSTQQRFIYIKFSNKDTLLVEPGFRFHLTQNADSEISHFCKKLREKCRHARVHRIYQFGFDRIAIIDLQRVRIVIEFFSAGNMLVLDENDQILELLRPVEELGIIRHSKYVFNSVDIDLSFNTFKECNNLSSILPFEKEYIEAIKERIQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.21
4 0.21
5 0.2
6 0.22
7 0.2
8 0.22
9 0.21
10 0.2
11 0.23
12 0.21
13 0.22
14 0.22
15 0.22
16 0.21
17 0.29
18 0.26
19 0.26
20 0.27
21 0.28
22 0.28
23 0.28
24 0.33
25 0.29
26 0.36
27 0.34
28 0.36
29 0.36
30 0.35
31 0.36
32 0.3
33 0.28
34 0.24
35 0.22
36 0.2
37 0.17
38 0.17
39 0.17
40 0.16
41 0.15
42 0.11
43 0.17
44 0.19
45 0.2
46 0.21
47 0.21
48 0.21
49 0.2
50 0.21
51 0.18
52 0.18
53 0.18
54 0.17
55 0.15
56 0.22
57 0.3
58 0.38
59 0.45
60 0.52
61 0.59
62 0.7
63 0.79
64 0.82
65 0.79
66 0.8
67 0.78
68 0.79
69 0.74
70 0.68
71 0.58
72 0.52
73 0.49
74 0.39
75 0.32
76 0.21
77 0.16
78 0.12
79 0.12
80 0.08
81 0.06
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.1
89 0.1
90 0.07
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.06
97 0.05
98 0.05
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.07
119 0.12
120 0.12
121 0.13
122 0.15
123 0.16
124 0.18
125 0.19
126 0.25
127 0.21
128 0.23
129 0.25
130 0.23
131 0.24
132 0.22
133 0.22
134 0.14
135 0.16
136 0.14
137 0.12
138 0.14
139 0.12
140 0.12
141 0.17
142 0.19
143 0.18
144 0.21
145 0.23
146 0.21
147 0.24
148 0.26
149 0.22
150 0.22
151 0.21
152 0.19
153 0.18
154 0.18
155 0.17
156 0.18
157 0.18
158 0.18
159 0.2