Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GKJ4

Protein Details
Accession L2GKJ4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-101DVGYRCRRRGVRRRKTVRGSIVBasic
179-202VSEERKQKIAKRRAEKEAKKKALLBasic
NLS Segment(s)
PositionSequence
87-94RRGVRRRK
183-200RKQKIAKRRAEKEAKKKA
Subcellular Location(s) mito 13.5, mito_nucl 11.5, nucl 8.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKINIAYPTNASQKSFEIKTKEEQRLYGKKINDQFDGALISPELAGSVVQIVGGNDYQGVPMTAAQATTKRIRLLLSKGDVGYRCRRRGVRRRKTVRGSIVSNEILVLNVVLVRPAEGKTVEGLTDVVKEKTHLPRRDRKLRAMFGIPEEEDTVSYIHRIIRENDENAVLPKIKITGVVSEERKQKIAKRRAEKEAKKKALLAEKAEYETKYGIKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.38
4 0.37
5 0.38
6 0.46
7 0.54
8 0.59
9 0.55
10 0.56
11 0.6
12 0.63
13 0.67
14 0.63
15 0.57
16 0.56
17 0.61
18 0.6
19 0.53
20 0.46
21 0.39
22 0.34
23 0.33
24 0.25
25 0.19
26 0.14
27 0.11
28 0.09
29 0.08
30 0.07
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.07
50 0.06
51 0.07
52 0.08
53 0.09
54 0.13
55 0.16
56 0.18
57 0.17
58 0.18
59 0.19
60 0.22
61 0.25
62 0.28
63 0.27
64 0.27
65 0.27
66 0.29
67 0.29
68 0.3
69 0.35
70 0.36
71 0.35
72 0.39
73 0.45
74 0.52
75 0.61
76 0.68
77 0.69
78 0.73
79 0.79
80 0.83
81 0.84
82 0.81
83 0.78
84 0.72
85 0.64
86 0.55
87 0.5
88 0.4
89 0.33
90 0.26
91 0.18
92 0.13
93 0.1
94 0.07
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.05
103 0.06
104 0.06
105 0.07
106 0.07
107 0.08
108 0.07
109 0.07
110 0.07
111 0.06
112 0.09
113 0.1
114 0.1
115 0.09
116 0.1
117 0.15
118 0.24
119 0.33
120 0.38
121 0.44
122 0.53
123 0.63
124 0.72
125 0.73
126 0.73
127 0.72
128 0.69
129 0.66
130 0.6
131 0.52
132 0.44
133 0.43
134 0.33
135 0.25
136 0.22
137 0.18
138 0.14
139 0.13
140 0.11
141 0.08
142 0.08
143 0.08
144 0.09
145 0.11
146 0.14
147 0.16
148 0.24
149 0.28
150 0.29
151 0.3
152 0.29
153 0.28
154 0.27
155 0.27
156 0.19
157 0.15
158 0.14
159 0.14
160 0.12
161 0.13
162 0.13
163 0.15
164 0.17
165 0.24
166 0.28
167 0.33
168 0.4
169 0.39
170 0.41
171 0.41
172 0.45
173 0.49
174 0.55
175 0.59
176 0.62
177 0.69
178 0.76
179 0.84
180 0.87
181 0.87
182 0.89
183 0.86
184 0.79
185 0.74
186 0.71
187 0.7
188 0.65
189 0.6
190 0.54
191 0.5
192 0.51
193 0.5
194 0.43
195 0.36
196 0.32