Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GK40

Protein Details
Accession L2GK40    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPVKRQNHGRQKKNRGATCNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPVKRQNHGRQKKNRGATCNVQCNQCGATVAKDKAISRSSNAPVVEAASMDDFRAATVYENVEVPTFLNIENHCISCACHLRIVKVRSKEDRKTRFVTRQRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.81
3 0.78
4 0.78
5 0.76
6 0.75
7 0.68
8 0.61
9 0.54
10 0.5
11 0.43
12 0.33
13 0.26
14 0.17
15 0.19
16 0.23
17 0.23
18 0.23
19 0.25
20 0.24
21 0.27
22 0.29
23 0.25
24 0.22
25 0.27
26 0.27
27 0.29
28 0.28
29 0.24
30 0.21
31 0.2
32 0.18
33 0.11
34 0.1
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.05
42 0.04
43 0.04
44 0.05
45 0.06
46 0.07
47 0.07
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.09
56 0.09
57 0.13
58 0.15
59 0.15
60 0.14
61 0.14
62 0.15
63 0.18
64 0.24
65 0.2
66 0.24
67 0.24
68 0.3
69 0.38
70 0.43
71 0.44
72 0.47
73 0.53
74 0.59
75 0.67
76 0.71
77 0.74
78 0.77
79 0.77
80 0.75
81 0.77
82 0.77
83 0.78