Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GPY2

Protein Details
Accession L2GPY2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-86SCRIYCSHSKRKTINCQDVIHydrophilic
NLS Segment(s)
PositionSequence
4-40RGKGAKGAKGVAKRHRKQPSSSSKISGPAIRRLARRA
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MAGRGKGAKGAKGVAKRHRKQPSSSSKISGPAIRRLARRAGVPRVGAGCFPEVNDAAVNYLTTLLDSCRIYCSHSKRKTINCQDVIYALKRLGTKYMGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.61
4 0.69
5 0.75
6 0.73
7 0.72
8 0.75
9 0.76
10 0.73
11 0.7
12 0.64
13 0.56
14 0.55
15 0.51
16 0.45
17 0.38
18 0.37
19 0.4
20 0.4
21 0.4
22 0.39
23 0.41
24 0.37
25 0.39
26 0.37
27 0.35
28 0.35
29 0.33
30 0.31
31 0.28
32 0.27
33 0.22
34 0.18
35 0.13
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.05
51 0.04
52 0.08
53 0.08
54 0.09
55 0.11
56 0.11
57 0.15
58 0.22
59 0.31
60 0.39
61 0.46
62 0.53
63 0.59
64 0.68
65 0.76
66 0.79
67 0.8
68 0.75
69 0.69
70 0.62
71 0.58
72 0.52
73 0.44
74 0.35
75 0.25
76 0.23
77 0.23
78 0.23
79 0.24