Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GQD6

Protein Details
Accession L2GQD6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-43GKGQRRCRRCNNHRGFNRMCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039744  40S_S29/30S_S14z  
IPR043140  Ribosomal_S14/S29  
Gene Ontology GO:0003735  F:structural constituent of ribosome  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MPHDLKVRSDVEKELPNSHAVHGGKGQRRCRRCNNHRGFNRMCDINLCRRCLHQNAEFIGFKIYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.32
4 0.3
5 0.28
6 0.29
7 0.23
8 0.22
9 0.23
10 0.29
11 0.32
12 0.39
13 0.47
14 0.48
15 0.54
16 0.59
17 0.65
18 0.69
19 0.73
20 0.77
21 0.78
22 0.8
23 0.79
24 0.8
25 0.73
26 0.66
27 0.61
28 0.51
29 0.42
30 0.36
31 0.34
32 0.37
33 0.39
34 0.37
35 0.34
36 0.36
37 0.41
38 0.42
39 0.45
40 0.41
41 0.43
42 0.44
43 0.49
44 0.46
45 0.41