Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GPR7

Protein Details
Accession L2GPR7   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
248-270DEEREERKRKMQEDSEKRRKARIBasic
NLS Segment(s)
PositionSequence
254-270RKRKMQEDSEKRRKARI
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004343  Plus-3_dom  
IPR036128  Plus3-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF03126  Plus-3  
Amino Acid Sequences MKSYDELLEAGELFADEDDKKRILSLPELQREKILHDRFKKINDSQLSCVLKELDRQDIPKEPRHTPKFEECDFILPRDMIINNIFKPFIGILKGCFVRAMINKKYVICKIMATRSIEPYKLLSKTSQMCTVGFDVDNGKKIVEGLQANVISSSAMTVEEFENFLSDFSIESFDDLKKKYKKVQHEFSRSLTDVEVNKTIENKLRDNPKKQTNTEKKIGIIAKRDDAMQSKDKEKAMFYQKQLEKIEDEEREERKRKMQEDSEKRRKARI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.1
5 0.13
6 0.14
7 0.14
8 0.15
9 0.19
10 0.21
11 0.26
12 0.33
13 0.4
14 0.49
15 0.52
16 0.52
17 0.52
18 0.49
19 0.48
20 0.49
21 0.47
22 0.46
23 0.5
24 0.57
25 0.58
26 0.63
27 0.66
28 0.59
29 0.6
30 0.59
31 0.57
32 0.53
33 0.57
34 0.53
35 0.45
36 0.44
37 0.37
38 0.29
39 0.29
40 0.28
41 0.27
42 0.27
43 0.29
44 0.3
45 0.37
46 0.41
47 0.44
48 0.47
49 0.46
50 0.54
51 0.59
52 0.6
53 0.57
54 0.63
55 0.61
56 0.57
57 0.55
58 0.45
59 0.46
60 0.43
61 0.38
62 0.3
63 0.23
64 0.21
65 0.2
66 0.19
67 0.13
68 0.15
69 0.17
70 0.16
71 0.17
72 0.17
73 0.14
74 0.15
75 0.14
76 0.12
77 0.11
78 0.1
79 0.1
80 0.16
81 0.16
82 0.15
83 0.14
84 0.13
85 0.16
86 0.21
87 0.27
88 0.25
89 0.29
90 0.31
91 0.32
92 0.36
93 0.33
94 0.29
95 0.22
96 0.21
97 0.21
98 0.24
99 0.26
100 0.27
101 0.27
102 0.31
103 0.32
104 0.3
105 0.26
106 0.24
107 0.24
108 0.21
109 0.2
110 0.16
111 0.19
112 0.23
113 0.24
114 0.25
115 0.23
116 0.22
117 0.22
118 0.22
119 0.18
120 0.14
121 0.12
122 0.12
123 0.11
124 0.13
125 0.12
126 0.11
127 0.1
128 0.1
129 0.11
130 0.12
131 0.12
132 0.1
133 0.14
134 0.14
135 0.14
136 0.14
137 0.12
138 0.08
139 0.07
140 0.07
141 0.03
142 0.03
143 0.03
144 0.04
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.07
157 0.06
158 0.07
159 0.09
160 0.1
161 0.13
162 0.15
163 0.23
164 0.27
165 0.31
166 0.38
167 0.44
168 0.54
169 0.6
170 0.69
171 0.71
172 0.75
173 0.75
174 0.71
175 0.69
176 0.59
177 0.5
178 0.4
179 0.33
180 0.26
181 0.25
182 0.25
183 0.2
184 0.2
185 0.2
186 0.22
187 0.24
188 0.26
189 0.26
190 0.29
191 0.39
192 0.47
193 0.53
194 0.59
195 0.63
196 0.68
197 0.69
198 0.75
199 0.75
200 0.74
201 0.73
202 0.67
203 0.58
204 0.57
205 0.58
206 0.51
207 0.48
208 0.44
209 0.4
210 0.38
211 0.38
212 0.34
213 0.33
214 0.34
215 0.34
216 0.35
217 0.35
218 0.39
219 0.41
220 0.4
221 0.38
222 0.4
223 0.43
224 0.46
225 0.46
226 0.51
227 0.52
228 0.58
229 0.59
230 0.53
231 0.45
232 0.42
233 0.46
234 0.39
235 0.41
236 0.4
237 0.43
238 0.5
239 0.53
240 0.53
241 0.54
242 0.59
243 0.58
244 0.61
245 0.65
246 0.68
247 0.73
248 0.81
249 0.83
250 0.84