Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GM58

Protein Details
Accession L2GM58    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-36RSHTPVCPKKIKPKAKNGRASIRHydrophilic
NLS Segment(s)
PositionSequence
22-38KKIKPKAKNGRASIRAK
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MPTAISINRAGKVRSHTPVCPKKIKPKAKNGRASIRAKYMKRLEMGYFDMKGKVKMNINTPRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.41
4 0.5
5 0.58
6 0.6
7 0.63
8 0.62
9 0.66
10 0.72
11 0.78
12 0.75
13 0.77
14 0.82
15 0.82
16 0.86
17 0.81
18 0.79
19 0.76
20 0.72
21 0.64
22 0.62
23 0.59
24 0.51
25 0.53
26 0.5
27 0.45
28 0.43
29 0.43
30 0.36
31 0.32
32 0.36
33 0.31
34 0.28
35 0.25
36 0.27
37 0.26
38 0.27
39 0.26
40 0.27
41 0.31
42 0.34
43 0.42