Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GMS3

Protein Details
Accession L2GMS3    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
332-351IKNYRLKSNYKLKSKSKVATHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 13.5, nucl 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
IPR039741  UDP-sugar_pyrophosphorylase  
IPR002618  UDPGP_fam  
Gene Ontology GO:0070569  F:uridylyltransferase activity  
Pfam View protein in Pfam  
PF01704  UDPGP  
Amino Acid Sequences MIPLSDKDIISPYNEDGNLNKQGEELFNEGVKVLTGGRKLGVVILSGGEGTRLGLTYPKGLFQIEGATLFEWHLKRLQCLYEKYKCELYLFIMTSDSTDKQVKEFFANKNYTFIKGIEIFKQSGIEALDMKTRQSLCRDGKVIMNPVGNGDFFDAIKKAQLRTKVEAFNVISVDNVLANILDEVYVGAFYKYNFETLSKAVKAMPNESVGAFFRDGEHIKIEEYSEAKARNGNNVYGNICNHLFTRAFVERVSEQKLPLHEAFKKIPFTNEKGMLVKPASPNGIKREKFIFDSFEFTTKNGVLSVPRNHEFSPLKNSAESPADNPVTCAAAIKNYRLKSNYKLKSKSKVATAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.3
5 0.34
6 0.32
7 0.3
8 0.25
9 0.26
10 0.26
11 0.27
12 0.25
13 0.19
14 0.19
15 0.19
16 0.18
17 0.17
18 0.15
19 0.12
20 0.1
21 0.12
22 0.13
23 0.14
24 0.15
25 0.15
26 0.15
27 0.17
28 0.15
29 0.12
30 0.11
31 0.1
32 0.1
33 0.09
34 0.09
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.06
41 0.09
42 0.1
43 0.15
44 0.16
45 0.17
46 0.18
47 0.18
48 0.18
49 0.15
50 0.17
51 0.13
52 0.13
53 0.12
54 0.12
55 0.12
56 0.12
57 0.16
58 0.13
59 0.14
60 0.18
61 0.19
62 0.21
63 0.25
64 0.3
65 0.32
66 0.39
67 0.46
68 0.49
69 0.52
70 0.53
71 0.53
72 0.48
73 0.43
74 0.37
75 0.33
76 0.3
77 0.27
78 0.24
79 0.2
80 0.19
81 0.19
82 0.2
83 0.17
84 0.14
85 0.16
86 0.16
87 0.17
88 0.2
89 0.21
90 0.24
91 0.29
92 0.31
93 0.35
94 0.4
95 0.39
96 0.42
97 0.41
98 0.38
99 0.33
100 0.29
101 0.25
102 0.25
103 0.26
104 0.24
105 0.26
106 0.24
107 0.23
108 0.23
109 0.19
110 0.16
111 0.15
112 0.11
113 0.1
114 0.1
115 0.14
116 0.13
117 0.14
118 0.15
119 0.16
120 0.17
121 0.19
122 0.27
123 0.27
124 0.32
125 0.33
126 0.31
127 0.34
128 0.35
129 0.36
130 0.3
131 0.27
132 0.22
133 0.21
134 0.21
135 0.16
136 0.14
137 0.1
138 0.08
139 0.07
140 0.08
141 0.07
142 0.07
143 0.09
144 0.1
145 0.11
146 0.14
147 0.21
148 0.24
149 0.28
150 0.33
151 0.34
152 0.32
153 0.35
154 0.32
155 0.27
156 0.23
157 0.19
158 0.13
159 0.1
160 0.1
161 0.06
162 0.05
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.02
169 0.02
170 0.02
171 0.02
172 0.03
173 0.03
174 0.03
175 0.04
176 0.04
177 0.07
178 0.07
179 0.08
180 0.08
181 0.09
182 0.11
183 0.12
184 0.17
185 0.14
186 0.15
187 0.16
188 0.18
189 0.18
190 0.19
191 0.19
192 0.15
193 0.16
194 0.15
195 0.15
196 0.13
197 0.14
198 0.12
199 0.1
200 0.09
201 0.12
202 0.13
203 0.12
204 0.13
205 0.12
206 0.12
207 0.12
208 0.12
209 0.11
210 0.11
211 0.11
212 0.13
213 0.14
214 0.14
215 0.17
216 0.17
217 0.23
218 0.24
219 0.25
220 0.25
221 0.26
222 0.28
223 0.26
224 0.26
225 0.21
226 0.19
227 0.18
228 0.15
229 0.16
230 0.15
231 0.13
232 0.19
233 0.18
234 0.19
235 0.18
236 0.21
237 0.2
238 0.24
239 0.28
240 0.23
241 0.22
242 0.24
243 0.26
244 0.28
245 0.28
246 0.3
247 0.28
248 0.31
249 0.35
250 0.37
251 0.4
252 0.35
253 0.4
254 0.4
255 0.42
256 0.45
257 0.44
258 0.42
259 0.4
260 0.39
261 0.37
262 0.32
263 0.31
264 0.26
265 0.25
266 0.27
267 0.27
268 0.31
269 0.34
270 0.43
271 0.39
272 0.41
273 0.43
274 0.42
275 0.44
276 0.42
277 0.41
278 0.32
279 0.36
280 0.35
281 0.33
282 0.31
283 0.26
284 0.28
285 0.22
286 0.21
287 0.17
288 0.16
289 0.16
290 0.22
291 0.29
292 0.33
293 0.35
294 0.37
295 0.37
296 0.44
297 0.44
298 0.41
299 0.44
300 0.4
301 0.4
302 0.38
303 0.39
304 0.35
305 0.37
306 0.34
307 0.26
308 0.3
309 0.31
310 0.3
311 0.3
312 0.27
313 0.23
314 0.21
315 0.21
316 0.14
317 0.19
318 0.22
319 0.28
320 0.34
321 0.35
322 0.41
323 0.43
324 0.48
325 0.49
326 0.57
327 0.6
328 0.63
329 0.7
330 0.72
331 0.79
332 0.83
333 0.8
334 0.79