L2GMR8

UniProt ID: L2GMR8   Organism: Vittaforma corneae (strain ATCC 50505)
Gene: VICG_00836   Protein: Ribosomal protein L29
Length: 145 AA

Protein Details

• Accession: L2GMR8
• Localization Confidence: Medium
• Confidence Score: 13.4
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  88-119	LRMRLTPAQKNRKTRSQKIHARKYPQRIFSFN	Hydrophilic

• NLS Segment(s):

  Position	Sequence
  81-109	KPKLTKALRMRLTPAQKNRKTRSQKIHAR

• Subcellular Location(s): nucl 20.5, cyto_nucl 13, cyto 4.5
• Family & Domain DBs:
  • InterPro:
    • IPR001854 Ribosomal_L29/L35
    • IPR036049 Ribosomal_L29/L35_sf
    • IPR045059 RL35
  • Gene Ontology:
    • GO:0022625 C:cytosolic large ribosomal subunit
    • GO:0003735 F:structural constituent of ribosome
    • GO:0000463 P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
    • GO:0006412 P:translation
  • Pfam:
    • PF00831 Ribosomal_L29
• Amino Acid Sequences: MFVSAEELRAKSYEELQEELVTLERAYMAMRQQEHSKTAEREEIREAKKNVARCKAVMREKKLRELVDQYKGQTNLPKQLKPKLTKALRMRLTPAQKNRKTRSQKIHARKYPQRIFSFNN

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.25
2, 0.26
3, 0.26
4, 0.26
5, 0.24
6, 0.23
7, 0.18
8, 0.13
9, 0.1
10, 0.08
11, 0.07
12, 0.07
13, 0.07
14, 0.08
15, 0.1
16, 0.14
17, 0.16
18, 0.18
19, 0.23
20, 0.25
21, 0.27
22, 0.28
23, 0.3
24, 0.28
25, 0.29
26, 0.34
27, 0.3
28, 0.3
29, 0.33
30, 0.38
31, 0.36
32, 0.41
33, 0.4
34, 0.4
35, 0.42
36, 0.45
37, 0.46
38, 0.45
39, 0.43
40, 0.38
41, 0.43
42, 0.44
43, 0.5
44, 0.51
45, 0.52
46, 0.54
47, 0.55
48, 0.6
49, 0.58
50, 0.51
51, 0.45
52, 0.45
53, 0.44
54, 0.41
55, 0.4
56, 0.35
57, 0.35
58, 0.35
59, 0.33
60, 0.31
61, 0.28
62, 0.31
63, 0.33
64, 0.36
65, 0.35
66, 0.43
67, 0.5
68, 0.5
69, 0.55
70, 0.56
71, 0.56
72, 0.61
73, 0.65
74, 0.67
75, 0.64
76, 0.61
77, 0.59
78, 0.57
79, 0.61
80, 0.61
81, 0.63
82, 0.64
83, 0.67
84, 0.75
85, 0.77
86, 0.79
87, 0.8
88, 0.81
89, 0.82
90, 0.82
91, 0.85
92, 0.86
93, 0.9
94, 0.88
95, 0.89
96, 0.88
97, 0.88
98, 0.86
99, 0.85
100, 0.8