Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GNK1

Protein Details
Accession L2GNK1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-25ITQTIQKVKLKRKKQVTWTEDHydrophilic
39-60VCCIFRSKDHSGCKHKNKYERGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSITITQTIQKVKLKRKKQVTWTEDTVDNERLNKKSSKVCCIFRSKDHSGCKHKNKYERG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.75
4 0.78
5 0.81
6 0.84
7 0.79
8 0.77
9 0.71
10 0.65
11 0.57
12 0.51
13 0.44
14 0.36
15 0.3
16 0.26
17 0.25
18 0.23
19 0.23
20 0.23
21 0.23
22 0.28
23 0.32
24 0.38
25 0.42
26 0.47
27 0.5
28 0.57
29 0.58
30 0.57
31 0.62
32 0.59
33 0.61
34 0.64
35 0.67
36 0.68
37 0.74
38 0.78
39 0.8
40 0.83