Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GMZ2

Protein Details
Accession L2GMZ2   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-24ASKKKSLPVISIKKKPKPVFEHydrophilic
NLS Segment(s)
PositionSequence
16-18KKK
Subcellular Location(s) mito_nucl 10.665, nucl 10.5, cyto_nucl 10.5, mito 10
Family & Domain DBs
Amino Acid Sequences MPSASKKKSLPVISIKKKPKPVFEERENLVSILRNEKAFRIQVFSFESIEIFEQFLLSKNIKFIKGFTSKALSKNEIHLLLNDGSSVLNAPRIILYSNMRDFTFIPYKFILSNDEKGSFVKNRFVLKSSSESYSATSLSSNDLDVAGFTADSLNYVQSVIILCMIKECKLKSICKEVQQVDPELRNMFVIKSELNLLCRYKFCTKTGESYKLNISHETVVKVCEKLGFYNVFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.77
4 0.83
5 0.81
6 0.8
7 0.77
8 0.78
9 0.78
10 0.77
11 0.76
12 0.69
13 0.67
14 0.59
15 0.5
16 0.4
17 0.34
18 0.28
19 0.26
20 0.25
21 0.23
22 0.23
23 0.25
24 0.29
25 0.29
26 0.28
27 0.28
28 0.26
29 0.28
30 0.32
31 0.31
32 0.27
33 0.23
34 0.22
35 0.17
36 0.18
37 0.15
38 0.1
39 0.08
40 0.07
41 0.07
42 0.1
43 0.12
44 0.12
45 0.12
46 0.16
47 0.2
48 0.21
49 0.21
50 0.2
51 0.25
52 0.3
53 0.31
54 0.29
55 0.32
56 0.34
57 0.39
58 0.42
59 0.37
60 0.33
61 0.35
62 0.36
63 0.32
64 0.29
65 0.24
66 0.23
67 0.2
68 0.19
69 0.15
70 0.11
71 0.09
72 0.08
73 0.08
74 0.05
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.09
82 0.11
83 0.14
84 0.16
85 0.17
86 0.17
87 0.18
88 0.18
89 0.21
90 0.26
91 0.22
92 0.22
93 0.21
94 0.22
95 0.21
96 0.21
97 0.21
98 0.16
99 0.2
100 0.19
101 0.2
102 0.19
103 0.19
104 0.22
105 0.2
106 0.18
107 0.19
108 0.21
109 0.23
110 0.24
111 0.25
112 0.24
113 0.23
114 0.26
115 0.24
116 0.22
117 0.2
118 0.2
119 0.19
120 0.19
121 0.16
122 0.12
123 0.1
124 0.09
125 0.1
126 0.09
127 0.08
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.05
147 0.07
148 0.07
149 0.07
150 0.1
151 0.11
152 0.13
153 0.16
154 0.17
155 0.22
156 0.27
157 0.32
158 0.34
159 0.43
160 0.46
161 0.5
162 0.57
163 0.52
164 0.54
165 0.53
166 0.51
167 0.45
168 0.42
169 0.37
170 0.3
171 0.27
172 0.21
173 0.19
174 0.16
175 0.13
176 0.13
177 0.11
178 0.11
179 0.16
180 0.17
181 0.18
182 0.22
183 0.23
184 0.24
185 0.26
186 0.31
187 0.34
188 0.37
189 0.37
190 0.4
191 0.41
192 0.48
193 0.55
194 0.58
195 0.52
196 0.52
197 0.56
198 0.54
199 0.53
200 0.45
201 0.39
202 0.36
203 0.36
204 0.36
205 0.3
206 0.28
207 0.28
208 0.26
209 0.24
210 0.23
211 0.22
212 0.21
213 0.26