Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GNJ3

Protein Details
Accession L2GNJ3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-104QIESGQKKKAKGKLRSNLRIHNHydrophilic
NLS Segment(s)
PositionSequence
89-97KKKAKGKLR
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 1, pero 1, E.R. 1, cysk 1
Family & Domain DBs
Amino Acid Sequences MILIIASSVLSWNLPSGHDNSEKSTGTDNPQKDDPSQPSPNEQPAENPNKSDDNSDKKEPDQPNVENNPAFPKVGGNSNLHSQIESGQKKKAKGKLRSNLRIHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.13
4 0.18
5 0.23
6 0.24
7 0.26
8 0.31
9 0.3
10 0.29
11 0.3
12 0.27
13 0.28
14 0.35
15 0.32
16 0.31
17 0.33
18 0.34
19 0.33
20 0.37
21 0.36
22 0.36
23 0.39
24 0.36
25 0.38
26 0.39
27 0.42
28 0.37
29 0.32
30 0.27
31 0.3
32 0.37
33 0.32
34 0.3
35 0.27
36 0.28
37 0.28
38 0.29
39 0.26
40 0.26
41 0.31
42 0.33
43 0.33
44 0.32
45 0.4
46 0.38
47 0.37
48 0.36
49 0.33
50 0.38
51 0.4
52 0.42
53 0.33
54 0.32
55 0.32
56 0.27
57 0.25
58 0.17
59 0.15
60 0.14
61 0.19
62 0.22
63 0.2
64 0.21
65 0.25
66 0.28
67 0.26
68 0.25
69 0.2
70 0.21
71 0.29
72 0.32
73 0.31
74 0.35
75 0.4
76 0.46
77 0.53
78 0.57
79 0.58
80 0.63
81 0.71
82 0.74
83 0.81
84 0.85