Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GN32

Protein Details
Accession L2GN32    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-43SSLKASSKLKSKNKKSLLSSHydrophilic
NLS Segment(s)
PositionSequence
33-35KSK
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
Amino Acid Sequences MTDKKSKKSNSESNITKESKLKQSSLKASSKLKSKNKKSLLSSDPGFIQYLNKYGTDFAKFVLPQNDPACASSGSKLDDTAIQTLLQESYEDYMKLKARFVNKKDEESNITEIQGISRGAGPDTFKAKVVLEGKKKIHDIVDLNENDYRLPFLLKTWSSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.66
3 0.6
4 0.55
5 0.54
6 0.53
7 0.51
8 0.49
9 0.47
10 0.53
11 0.59
12 0.61
13 0.61
14 0.57
15 0.59
16 0.61
17 0.62
18 0.63
19 0.65
20 0.68
21 0.71
22 0.76
23 0.78
24 0.81
25 0.77
26 0.77
27 0.71
28 0.67
29 0.59
30 0.5
31 0.42
32 0.35
33 0.3
34 0.21
35 0.19
36 0.13
37 0.15
38 0.14
39 0.13
40 0.13
41 0.14
42 0.16
43 0.16
44 0.16
45 0.13
46 0.16
47 0.16
48 0.18
49 0.21
50 0.2
51 0.22
52 0.22
53 0.24
54 0.2
55 0.2
56 0.2
57 0.15
58 0.15
59 0.12
60 0.13
61 0.12
62 0.12
63 0.11
64 0.1
65 0.11
66 0.12
67 0.11
68 0.1
69 0.09
70 0.08
71 0.09
72 0.08
73 0.07
74 0.06
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.1
81 0.14
82 0.15
83 0.17
84 0.19
85 0.27
86 0.36
87 0.38
88 0.46
89 0.45
90 0.5
91 0.5
92 0.5
93 0.45
94 0.41
95 0.43
96 0.32
97 0.29
98 0.25
99 0.22
100 0.19
101 0.17
102 0.13
103 0.09
104 0.1
105 0.1
106 0.09
107 0.11
108 0.13
109 0.14
110 0.18
111 0.18
112 0.17
113 0.19
114 0.19
115 0.24
116 0.28
117 0.33
118 0.37
119 0.44
120 0.46
121 0.5
122 0.51
123 0.47
124 0.43
125 0.4
126 0.36
127 0.33
128 0.39
129 0.34
130 0.36
131 0.35
132 0.33
133 0.27
134 0.24
135 0.21
136 0.13
137 0.14
138 0.12
139 0.13
140 0.21