Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L2GLS2

Protein Details
Accession L2GLS2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-106QKTRELVQSKREQRKKKHTKKNQKKVEDKENYKSVFKKIHKKFHKKKBasic
NLS Segment(s)
PositionSequence
69-106KREQRKKKHTKKNQKKVEDKENYKSVFKKIHKKFHKKK
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MEKLRFDAEVENEMIETAFRERAMEKLLQMNVPPFTAVDMELARSEKEISKCLSILEREQKTRELVQSKREQRKKKHTKKNQKKVEDKENYKSVFKKIHKKFHKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.11
3 0.1
4 0.08
5 0.09
6 0.08
7 0.1
8 0.1
9 0.12
10 0.16
11 0.16
12 0.16
13 0.2
14 0.22
15 0.21
16 0.21
17 0.22
18 0.19
19 0.18
20 0.17
21 0.11
22 0.1
23 0.1
24 0.09
25 0.08
26 0.07
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.12
34 0.13
35 0.15
36 0.16
37 0.16
38 0.16
39 0.16
40 0.17
41 0.14
42 0.18
43 0.24
44 0.25
45 0.26
46 0.28
47 0.29
48 0.29
49 0.31
50 0.32
51 0.3
52 0.3
53 0.36
54 0.44
55 0.52
56 0.6
57 0.67
58 0.7
59 0.73
60 0.82
61 0.86
62 0.87
63 0.89
64 0.9
65 0.93
66 0.95
67 0.96
68 0.95
69 0.94
70 0.93
71 0.91
72 0.9
73 0.9
74 0.85
75 0.82
76 0.79
77 0.72
78 0.68
79 0.62
80 0.57
81 0.57
82 0.58
83 0.6
84 0.62
85 0.7
86 0.76