Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GW23

Protein Details
Accession L2GW23   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-31HDFLIEKKRRNNGRSKKNRGHPGNVRCDNCHydrophilic
85-104HSRLVRVRSHWERKIRGKVNBasic
NLS Segment(s)
PositionSequence
8-21KKRRNNGRSKKNRG
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences VHDFLIEKKRRNNGRSKKNRGHPGNVRCDNCARMVPKDKGIVKYQVKNLIDAAAADDIRVASIYETYEVPKTYVKLQYCVSCAVHSRLVRVRSHWERKIRGKVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.87
4 0.87
5 0.88
6 0.91
7 0.87
8 0.86
9 0.85
10 0.83
11 0.83
12 0.81
13 0.72
14 0.64
15 0.61
16 0.52
17 0.44
18 0.4
19 0.31
20 0.3
21 0.36
22 0.35
23 0.36
24 0.41
25 0.43
26 0.41
27 0.42
28 0.44
29 0.41
30 0.44
31 0.44
32 0.45
33 0.42
34 0.39
35 0.36
36 0.28
37 0.23
38 0.17
39 0.14
40 0.08
41 0.07
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.04
48 0.03
49 0.04
50 0.04
51 0.05
52 0.06
53 0.08
54 0.09
55 0.09
56 0.11
57 0.12
58 0.13
59 0.17
60 0.23
61 0.23
62 0.25
63 0.28
64 0.3
65 0.3
66 0.33
67 0.29
68 0.24
69 0.26
70 0.26
71 0.3
72 0.27
73 0.31
74 0.34
75 0.37
76 0.38
77 0.38
78 0.45
79 0.49
80 0.58
81 0.61
82 0.64
83 0.69
84 0.76