Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GXA0

Protein Details
Accession L2GXA0   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
159-184FNIKMDNKVRNRLKKRNNWPTFPQIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR002109  Glutaredoxin  
IPR004480  Monothiol_GRX-rel  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0015036  F:disulfide oxidoreductase activity  
Pfam View protein in Pfam  
PF00462  Glutaredoxin  
PROSITE View protein in PROSITE  
PS51354  GLUTAREDOXIN_2  
Amino Acid Sequences MDHSPHELSAEEKRNEDELNNIFFKLQNYTNIIAYEKDEKEIDLLLKYIDDDEYIIVNLSISPILRDRFVKTYAVKKLPILISYSTNIYNDEKLSACLEERKVNEDSFIDHKIDRMVGEKKVMIFIKGSPDKPECKFTKELISQFDELQLKNGKDYSYFNIKMDNKVRNRLKKRNNWPTFPQIYIDRLFVGGLDTFKKMKEKKIVQKMLFPGDKEEID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.33
4 0.31
5 0.26
6 0.3
7 0.3
8 0.27
9 0.26
10 0.26
11 0.27
12 0.25
13 0.23
14 0.22
15 0.25
16 0.27
17 0.28
18 0.28
19 0.27
20 0.23
21 0.23
22 0.26
23 0.22
24 0.22
25 0.21
26 0.2
27 0.2
28 0.21
29 0.2
30 0.13
31 0.13
32 0.1
33 0.1
34 0.1
35 0.1
36 0.08
37 0.07
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.09
51 0.1
52 0.12
53 0.14
54 0.16
55 0.19
56 0.21
57 0.25
58 0.25
59 0.32
60 0.38
61 0.4
62 0.38
63 0.35
64 0.38
65 0.35
66 0.33
67 0.28
68 0.21
69 0.2
70 0.2
71 0.21
72 0.16
73 0.15
74 0.16
75 0.15
76 0.14
77 0.12
78 0.12
79 0.11
80 0.11
81 0.12
82 0.1
83 0.1
84 0.12
85 0.13
86 0.16
87 0.16
88 0.19
89 0.2
90 0.2
91 0.2
92 0.17
93 0.18
94 0.16
95 0.17
96 0.15
97 0.13
98 0.13
99 0.13
100 0.13
101 0.11
102 0.12
103 0.13
104 0.13
105 0.15
106 0.15
107 0.15
108 0.18
109 0.18
110 0.15
111 0.13
112 0.13
113 0.2
114 0.23
115 0.24
116 0.24
117 0.27
118 0.31
119 0.32
120 0.39
121 0.32
122 0.34
123 0.37
124 0.34
125 0.41
126 0.41
127 0.42
128 0.38
129 0.4
130 0.35
131 0.32
132 0.35
133 0.28
134 0.23
135 0.24
136 0.25
137 0.21
138 0.21
139 0.23
140 0.18
141 0.18
142 0.21
143 0.22
144 0.26
145 0.28
146 0.27
147 0.34
148 0.35
149 0.41
150 0.45
151 0.48
152 0.44
153 0.52
154 0.61
155 0.64
156 0.72
157 0.75
158 0.79
159 0.81
160 0.88
161 0.89
162 0.88
163 0.84
164 0.81
165 0.81
166 0.74
167 0.65
168 0.57
169 0.49
170 0.45
171 0.4
172 0.34
173 0.25
174 0.2
175 0.19
176 0.15
177 0.13
178 0.11
179 0.11
180 0.12
181 0.14
182 0.14
183 0.17
184 0.25
185 0.27
186 0.34
187 0.43
188 0.52
189 0.6
190 0.71
191 0.79
192 0.74
193 0.78
194 0.76
195 0.75
196 0.69
197 0.59
198 0.53