Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L2GS27

Protein Details
Accession L2GS27    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35LHHKTVKTPFPRKSKKFDFSKSQKTFHydrophilic
55-84MDMIKKSQDKRVKRYLRKRLGNLKCAKKKIHydrophilic
NLS Segment(s)
PositionSequence
64-75KRVKRYLRKRLG
Subcellular Location(s) nucl 19.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MILNKKARSLHHKTVKTPFPRKSKKFDFSKSQKTFFARDIVREIVGRAPYELCAMDMIKKSQDKRVKRYLRKRLGNLKCAKKKIDSLTAEIHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.76
4 0.75
5 0.73
6 0.74
7 0.79
8 0.79
9 0.8
10 0.8
11 0.8
12 0.79
13 0.78
14 0.78
15 0.77
16 0.82
17 0.77
18 0.71
19 0.66
20 0.6
21 0.55
22 0.46
23 0.44
24 0.34
25 0.3
26 0.3
27 0.26
28 0.24
29 0.21
30 0.2
31 0.15
32 0.15
33 0.14
34 0.11
35 0.1
36 0.09
37 0.1
38 0.1
39 0.07
40 0.07
41 0.07
42 0.1
43 0.11
44 0.12
45 0.15
46 0.19
47 0.21
48 0.29
49 0.37
50 0.42
51 0.48
52 0.58
53 0.65
54 0.72
55 0.81
56 0.83
57 0.85
58 0.87
59 0.88
60 0.88
61 0.86
62 0.86
63 0.84
64 0.84
65 0.83
66 0.79
67 0.75
68 0.69
69 0.68
70 0.66
71 0.66
72 0.59
73 0.55